PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g11350.1
Common NameBZIP02, Os01g0211800, P0031E09.34
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 331aa    MW: 35691.6 Da    PI: 7.5064
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g11350.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.49.8e-11190235550
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                       kr +r   NR +A+rsR RK+++i eLe+ v +L++e +aL  ++ 
  LOC_Os01g11350.1 190 KRVKRILANRQSAQRSRVRKLQYISELERSVTSLQTEVSALSPRVA 235
                       8999*********************************999987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.6E-14186250IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.76188244IPR004827Basic-leucine zipper domain
PfamPF001705.6E-10190240IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.41E-11190244No hitNo description
Gene3DG3DSA:1.20.5.1705.7E-14190244No hitNo description
CDDcd147033.00E-25191241No hitNo description
PROSITE patternPS000360193208IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0025281anatomypollen
PO:0001015developmental stageK second mitotic division stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MAQLPPKIPT MATAWPEFGG GHHHHAAHGH HHQRSPSMGA FLAAPLPPFP LPPPAPANGG  60
AQQQQQQQQH QPSWVDEFLD FSATKRGAHR RSVSDSVAFL DPVSDDNAGV GAHDFDRLDD  120
DQLMSMFSDD LQPPPPQQQP AAPAASASSP SDHNSMNDEK QDKGETDEAQ SECDGATPGQ  180
PASPATVDPK RVKRILANRQ SAQRSRVRKL QYISELERSV TSLQTEVSAL SPRVAFLDHQ  240
RSLLTLGNSH LKQRIAALAQ DKIFKDGGTE EGDREAAANL PPAKPQERGI PTGGRGPGPR  300
PRQCRPDRQR GGRRGRAMPA LVIGRDPDAL *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.333360.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329861530.0
Expression AtlasQ5QNI5-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, shoots and panicles. {ECO:0000269|PubMed:18065552}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription regulator. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g11350.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by dehydration and salt stress. {ECO:0000269|PubMed:18065552}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g11350
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1009440.0AK100944.1 Oryza sativa Japonica Group cDNA clone:J023138F18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635844.11e-137PREDICTED: basic leucine zipper 2-like
SwissprotQ5QNI50.0BZP02_ORYSJ; Basic leucine zipper 2
TrEMBLJ3KXK71e-151J3KXK7_ORYBR; Uncharacterized protein
STRINGLOC_Os01g11350.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12617181
MonocotsOGMP132238125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.17e-77bZIP family protein
Publications ? help Back to Top
  1. Nijhawan A,Jain M,Tyagi AK,Khurana JP
    Genomic survey and gene expression analysis of the basic leucine zipper transcription factor family in rice.
    Plant Physiol., 2008. 146(2): p. 333-50
    [PMID:18065552]