PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g10610.1
Common NameBZR2, LOC4327076, Os01g0203000, P0489A05.32
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family BES1
Protein Properties Length: 366aa    MW: 37921.4 Da    PI: 8.8819
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g10610.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822211.42.4e-65281752150
            DUF822   2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspessl 94 
                        +gr+ptw+ErEnnkrRERrRRaiaaki+aGLRa+G+yklpk++DnneVlkALc+eAGwvve+DGttyrkg+kp+e++e++g+s s sp+ss+
  LOC_Os01g10610.1  28 VGGRMPTWRERENNKRRERRRRAIAAKIFAGLRAHGGYKLPKHCDNNEVLKALCNEAGWVVEPDGTTYRKGYKPPERMEVIGCSVSPSPCSSY 120
                       689****************************************************************************************** PP

            DUF822  95 qsslkssalaspvesysaspksssfpspssldsislasa.......asllpvlsvlslvsssl 150
                       q        +sp++sy+asp+sssfps +s+ ++++ ++       + +lp+l++ls+++ss+
  LOC_Os01g10610.1 121 Q--------PSPRASYNASPTSSSFPSGASSPFLPHPNNmangvdgNPILPWLKTLSNSPSSK 175
                       *........99*******************999999988999999999********9999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056878.2E-6529169IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009742Biological Processbrassinosteroid mediated signaling pathway
GO:0040008Biological Processregulation of growth
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009030anatomycarpel
PO:0007130developmental stagesporophyte reproductive stage
PO:0007606developmental stagegynoecium development stage
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MATGGGGGGG GMGGGGVGGG AGAAGVGVGG RMPTWREREN NKRRERRRRA IAAKIFAGLR  60
AHGGYKLPKH CDNNEVLKAL CNEAGWVVEP DGTTYRKGYK PPERMEVIGC SVSPSPCSSY  120
QPSPRASYNA SPTSSSFPSG ASSPFLPHPN NMANGVDGNP ILPWLKTLSN SPSSKKHPQL  180
PPLLIHGGSI SAPVTPPLSS PTARTPRMKT DWDESNVQPT WTGSNSPCVV NSTPPSPGRT  240
MLPDPAWLAG IQISSTSPSS PTFSLVSSNP FSVFKDAILV GNNSSRMCTP GQSGTCSPAI  300
PGMAPHPDIH MMDAVSDEFA FGSSTNGGHQ AAGLVRAWEG ERIHEDSGSD DLELTLGSSR  360
TRAAA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.13020.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329774890.0
Expression AtlasQ0JPT4-
Functional Description ? help Back to Top
Source Description
UniProtMay function in brassinosteroid signaling. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g10610.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g10610
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0674710.0AK067471.1 Oryza sativa Japonica Group cDNA clone:J013107L10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015622415.10.0PREDICTED: protein BZR1 homolog 2
SwissprotQ0JPT40.0BZR2_ORYSJ; Protein BZR1 homolog 2
TrEMBLA0A0E0MST50.0A0A0E0MST5_ORYRU; Uncharacterized protein
STRINGLOC_Os01g10610.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP136638112
Representative plantOGRP15951542
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.18e-83BES1/BZR1 homolog 4