PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g10504.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MIKC_MADS
Protein Properties Length: 277aa    MW: 30902.8 Da    PI: 9.4035
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g10504.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF991.9e-314998150
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                      krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey+
  LOC_Os01g10504.2 49 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA 98
                      79***********************************************8 PP

2K-box99.35.6e-33117213499
             K-box   4 ssgks.leeakaeslqqelakLkkeienLq.reqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 
                       s++   ++e +a+++qqe++kL+++i++Lq  + R ++G++++++sl++L+q+e++Lek++ kiR++Knell++++e++qk+e elq++n++L
  LOC_Os01g10504.2 117 SNS-GtVAEVNAQHYQQESSKLRQQISSLQnANSRTIVGDSINTMSLRDLKQVENRLEKGIAKIRARKNELLYAEVEYMQKREVELQNDNMYL 208
                       333.25999*********************9899*********************************************************** PP

             K-box  95 rkkle 99 
                       r+k+ 
  LOC_Os01g10504.2 209 RSKVV 213
                       **986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.1E-4241100IPR002100Transcription factor, MADS-box
PROSITE profilePS5006634.13241101IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.84E-3342113IPR002100Transcription factor, MADS-box
CDDcd002652.72E-4642115No hitNo description
PROSITE patternPS0035004397IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-334363IPR002100Transcription factor, MADS-box
PfamPF003191.1E-265097IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-336378IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-337899IPR002100Transcription factor, MADS-box
PfamPF014861.2E-22126212IPR002487Transcription factor, K-box
PROSITE profilePS5129713.805127218IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010097Biological Processspecification of stamen identity
GO:0048366Biological Processleaf development
GO:0048440Biological Processcarpel development
GO:0048497Biological Processmaintenance of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MMNMMTDLSC GPSSMTELTA AAAPAGSGSS AAVAAGSSEK MGRGKIEIKR IENTTNRQVT  60
FCKRRNGLLK KAYELSVLCD AEVALIVFSS RGRLYEYANN SVKSTVERYK KANSDTSNSG  120
TVAEVNAQHY QQESSKLRQQ ISSLQNANSR TIVGDSINTM SLRDLKQVEN RLEKGIAKIR  180
ARKNELLYAE VEYMQKREVE LQNDNMYLRS KVVENERGQQ PLNMMGAAST SEYDHMVNNP  240
YDSRNFLQVN IMQQPQHYAH QLQPTTLQLG QQPAFN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-2141109169Myocyte-specific enhancer factor 2B
1tqe_Q2e-2141109169Myocyte-specific enhancer factor 2B
1tqe_R2e-2141109169Myocyte-specific enhancer factor 2B
1tqe_S2e-2141109169Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00609ChIP-seqTransfer from AT4G18960Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g10504.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g10504
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankRICOSMAB3A0.0L37528.1 Oryza sativa MADS-box protein (MADS3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015632490.10.0PREDICTED: MADS-box transcription factor 3 isoform X1
SwissprotQ407041e-178MADS3_ORYSJ; MADS-box transcription factor 3
TrEMBLA0A0E0FI670.0A0A0E0FI67_ORYNI; Uncharacterized protein
STRINGLOC_Os01g10504.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.11e-102MIKC_MADS family protein