PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g09720.1
Common NameLOC107281590, P0001B06.2, P0671B11.33
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Dof
Protein Properties Length: 216aa    MW: 22188.4 Da    PI: 9.6214
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g09720.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.33.4e-382882458
            zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrkn 58
                      + l+cprC+stntkfCyynny+l+qPr+fCkaCrryWt+GGalrnvPvGgg+r++
  LOC_Os01g09720.1 28 EGLACPRCESTNTKFCYYNNYNLAQPRHFCKACRRYWTRGGALRNVPVGGGTRNK 82
                      6789*************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027012.0E-323082IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.4163084IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103268IPR003851Zinc finger, Dof-type
ProDomPD0074785.0E-233280IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MEVAEGRTVA AAAAGGGGLG GGARTEAEGL ACPRCESTNT KFCYYNNYNL AQPRHFCKAC  60
RRYWTRGGAL RNVPVGGGTR NKVAPAPCTG RRKRAAHAAH AAAPPPTTTA SSAPLPLMPP  120
AVAYELPFLP PPPPLPLAAV DPDRRLLDLG GSFTSLLAPA QLHNGHFTTG FLLGTMSSAP  180
PPPPPPATST PSPAPAAHPP VSDSIWAMGW PHLSI*
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ9FE00
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g09720.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g09720
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0027460.0AP002746.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0671B11.
GenBankAP0025370.0AP002537.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0001B06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645936.11e-151PREDICTED: dof zinc finger protein DOF3.1-like
TrEMBLQ9FE001e-151Q9FE00_ORYSJ; Putative DNA-binding protein Dof3
STRINGLOC_Os01g09720.11e-151(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.12e-29DOF zinc finger protein 1