PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g09640.1
Common NameLOC4327305, Os01g0192300, OsJ_00711, OSNPB_010192300, P0671B11.19-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 311aa    MW: 33037.4 Da    PI: 9.9691
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g09640.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.63.8e-15125169347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +WT+eE+ +++ + ++lG+g+W+ I+r++ ++Rt+ q+ s+ qky
  LOC_Os01g09640.1 125 PWTEEEHRKFLVGLEKLGKGDWRGISRHFVTTRTPTQVASHAQKY 169
                       8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.68318IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129419.454118174IPR017930Myb domain
SuperFamilySSF466899.72E-19119175IPR009057Homeodomain-like
TIGRFAMsTIGR015574.4E-18121173IPR006447Myb domain, plants
SMARTSM007177.0E-12122172IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-11122168IPR009057Homeodomain-like
CDDcd001672.26E-10125170No hitNo description
PfamPF002491.2E-12125169IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006338Biological Processchromatin remodeling
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0035066Biological Processpositive regulation of histone acetylation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003713Molecular Functiontranscription coactivator activity
GO:0004402Molecular Functionhistone acetyltransferase activity
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000032anatomytetrad of microspores
PO:0001029developmental stageE tetrad stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MARKCSSCGN NGHNSRTCTG QRSLQESGGG YGGGGAGGVR LFGVQLHVGG APLKKCFSME  60
CLSSPSPSPS PAYYAAVAAA ASNSSPTVSS SSSLVSVEEA GEKMANGYLS DGLMARAQER  120
KKGVPWTEEE HRKFLVGLEK LGKGDWRGIS RHFVTTRTPT QVASHAQKYF LRQSSLTQKK  180
RRSSLFDVIE DAEKAPSVNE RLKLRHETAS VPAEMGFPAL SLGISSMAQP EAMLLPPPSL  240
TLTPSCSSPA VSSSSSEQPR TIHPSLMVAK PQVQLQLQPP DLELKISTVR QNDQPSSSPR  300
TPFLGTIRVT *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.6230.0callus| flower| leaf| panicle| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329876120.0
Expression AtlasQ5SNG6-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00565DAPTransfer from AT5G56840Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g09640.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g09640
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0621090.0AK062109.1 Oryza sativa Japonica Group cDNA clone:001-045-B07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015625837.10.0PREDICTED: transcription factor MYB1R1
TrEMBLQ5SNG60.0Q5SNG6_ORYSJ; Os01g0192300 protein
STRINGLOC_Os01g09640.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3941699
MonocotsOGMP42313873
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.12e-49MYB_related family protein