PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g09590.1
Common NameLOC4327303, Os01g0191900, OsJ_00708, OSNPB_010191900, P0671B11.5, P0710E05.40
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 265aa    MW: 27979.3 Da    PI: 6.0167
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g09590.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.97.1e-161462148
                      TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                      rg+W++eEd+ l d+++++G+  +W + +++ g++R++k+c++rw++yl
  LOC_Os01g09590.1 14 RGPWSPEEDDALRDYINRHGTAgNWISLPNKAGLRRCGKSCRLRWLNYL 62
                      89******************99*************************97 PP

2Myb_DNA-binding45.32e-1469111246
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       g++T eEd ++  +  +lG++ W+tIa+ +  +Rt++++k++w++
  LOC_Os01g09590.1  69 GAFTDEEDAIITSLYSKLGSK-WSTIAAQLE-RRTDNDVKNHWNT 111
                       89*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.286962IPR017930Myb domain
SuperFamilySSF466891.68E-2612109IPR009057Homeodomain-like
SMARTSM007173.3E-111364IPR001005SANT/Myb domain
PfamPF002491.4E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-231569IPR009057Homeodomain-like
CDDcd001675.78E-91662No hitNo description
PROSITE profilePS5129423.363117IPR017930Myb domain
SMARTSM007179.8E-1267115IPR001005SANT/Myb domain
PfamPF002493.5E-1269111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.1E-2370117IPR009057Homeodomain-like
CDDcd001676.59E-970111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020104anatomyleaf sheath
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MGRTPCCDRE AVKRGPWSPE EDDALRDYIN RHGTAGNWIS LPNKAGLRRC GKSCRLRWLN  60
YLRPDIRHGA FTDEEDAIIT SLYSKLGSKW STIAAQLERR TDNDVKNHWN TKLKRRLAAA  120
AACTPLLPLP APPPLAATHT SPSSSLLLLP PLAVPTVKTE AYTCDDFLQQ LLPTATAATA  180
LRDPFADGAA TDGGSTSASA ASSGSNWSAD TGVVVVGGGG GGGLFPEFCM SSDDLAGAAT  240
AEDDHFIGGG YYYPLDPSLS SSLV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-23141177108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.102040.0callus| leaf| panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329943340.0
Expression AtlasQ9LG70-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g09590.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g09590
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1091250.0AK109125.1 Oryza sativa Japonica Group cDNA clone:002-155-D04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628427.10.0PREDICTED: transcription factor RAX2
RefseqXP_015628419.10.0PREDICTED: transcription factor RAX2
TrEMBLQ9LG700.0Q9LG70_ORYSJ; Os01g0191900 protein
STRINGLOC_Os01g09590.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36890.18e-63MYB family protein