PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g09100.1
Common NameLOC4325658, Os01g0186000, OsJ_00671
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WRKY
Protein Properties Length: 220aa    MW: 22640.1 Da    PI: 7.5561
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g09100.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY94.29.2e-30106164159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDg++WrKYG+K vk+s++pr+YYrC+ agC vkk+ver+ +dp++v++tY g Hnh 
  LOC_Os01g09100.1 106 LDDGFKWRKYGKKAVKSSPNPRNYYRCSAAGCGVKKRVERDGDDPRYVVTTYDGVHNHA 164
                       59********************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.809.3E-3193166IPR003657WRKY domain
SuperFamilySSF1182903.79E-2798166IPR003657WRKY domain
PROSITE profilePS5081131.089101166IPR003657WRKY domain
SMARTSM007741.3E-33106165IPR003657WRKY domain
PfamPF031061.8E-23107163IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020104anatomyleaf sheath
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MAASLGLCHE TSYAYSYPAS NTSSSLCFPP LMADHIVDGG GGGGCSFGEF LELGHSVYSL  60
PLPPPPSQPV VVAGGNNDQY GVSSSSSAAA TTSRIGFRTR SEVEVLDDGF KWRKYGKKAV  120
KSSPNPRNYY RCSAAGCGVK KRVERDGDDP RYVVTTYDGV HNHATPGCVG GGGHLPYPTS  180
AAPPWSVPAA AASPPPAHAQ AWGAPLHAAA AAHSSESSF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A9e-2796166777Probable WRKY transcription factor 4
2lex_A9e-2796166777Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.299790.0leaf| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO335191950.0
Expression AtlasQ7XAA3-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g09100.1
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g09100
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3418540.0AY341854.1 Oryza sativa (japonica cultivar-group) WRKY13 mRNA, complete cds.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0024860.0AP002486.1 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0510F03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015633261.11e-159PREDICTED: probable WRKY transcription factor 50
TrEMBLQ7XAA31e-159Q7XAA3_ORYSJ; Os01g0186000 protein
STRINGLOC_Os01g09100.11e-158(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
MonocotsOGMP44137206
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.18e-38WRKY DNA-binding protein 50