PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g08710.2
Common NameLOC4325330, Os01g0182700, OsJ_00642, OSNPB_010182700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WRKY
Protein Properties Length: 281aa    MW: 29827.3 Da    PI: 10.2304
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g08710.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1023.5e-32203261159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDgy+WrKYGqK+vk++++prsYYrCt+ +C+vkk+ver aedp++v++tYeg+H h+
  LOC_Os01g08710.2 203 LDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVERLAEDPRMVITTYEGRHVHS 261
                       59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.2E-33188261IPR003657WRKY domain
SuperFamilySSF1182901.57E-28195262IPR003657WRKY domain
PROSITE profilePS5081129.356198263IPR003657WRKY domain
SMARTSM007749.8E-37203262IPR003657WRKY domain
PfamPF031064.9E-25204260IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901141Biological Processregulation of lignin biosynthetic process
GO:1904369Biological Processpositive regulation of sclerenchyma cell differentiation
GO:0016021Cellular Componentintegral component of membrane
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020048anatomymicrospore
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MFPSPGRAVM ALGHHGAARQ PPTTMAAAAS SSTTSAAAAP ATATTTVAFS FQHPTPTPSH  60
HHHHHGVLGY SPLVLDHHHP TTAAASSHAP SPPTLHHHHG GGLHAAAPPP RSSPPHPWSC  120
EEGDHRGRPQ MGNKGEAAAA MGAMGINDAG NNTAAAAAAQ HHLGVGAVRM KKVGGGGGGG  180
GKARRKVREP RFCFKTMSDV DVLDDGYKWR KYGQKVVKNT QHPRSYYRCT QDNCRVKKRV  240
ERLAEDPRMV ITTYEGRHVH SPSRDDDDAA RASAEMTFIW *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-25194260874Probable WRKY transcription factor 4
2lex_A2e-25194260874Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.557620.0panicle| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154349250.0
Expression AtlasB7F1L8-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g08710.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g08710
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1087550.0AK108755.1 Oryza sativa Japonica Group cDNA clone:002-150-F11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015632233.10.0PREDICTED: probable WRKY transcription factor 13 isoform X2
SwissprotQ9SVB74e-57WRK13_ARATH; Probable WRKY transcription factor 13
TrEMBLA0A0E0FH830.0A0A0E0FH83_ORYNI; Uncharacterized protein
TrEMBLB7F1L80.0B7F1L8_ORYSJ; Os01g0182700 protein
TrEMBLB8ADL50.0B8ADL5_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA002245-PA0.0(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39410.14e-46WRKY DNA-binding protein 13