PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g08710.1
Common NameOs01g0182700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WRKY
Protein Properties Length: 425aa    MW: 45967.1 Da    PI: 10.0694
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g08710.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.16.7e-32134192159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDgy+WrKYGqK+vk++++prsYYrCt+ +C+vkk+ver aedp++v++tYeg+H h+
  LOC_Os01g08710.1 134 LDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVERLAEDPRMVITTYEGRHVHS 192
                       59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.5E-33119192IPR003657WRKY domain
SuperFamilySSF1182903.27E-28126193IPR003657WRKY domain
PROSITE profilePS5081129.356129194IPR003657WRKY domain
SMARTSM007749.8E-37134193IPR003657WRKY domain
PfamPF031069.3E-25135191IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901141Biological Processregulation of lignin biosynthetic process
GO:1904369Biological Processpositive regulation of sclerenchyma cell differentiation
GO:0016021Cellular Componentintegral component of membrane
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020048anatomymicrospore
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MALGHHGAAR QPPTTMAAAA SSSTTSAAAA PATATTTVAF SFQHPTPTPS CEEGDHRGRP  60
QMGNKGEAAA AMGAMGINDA GNNTAAAAAA QHHLGVGAVR MKKVGGGGGG GGKARRKVRE  120
PRFCFKTMSD VDVLDDGYKW RKYGQKVVKN TQHPRSYYRC TQDNCRVKKR VERLAEDPRM  180
VITTYEGRHV HSPSRDDDDA ARASAEMTFI CPLNRRNVPY GALLNSYGMP HFMIIVQIAF  240
STIYVVLVLL VAVTHVDSSL QGVYFGGNSS SAAAAAASQM SNQILIEFNQ IYYFRFEFLK  300
NHLNSSLMLT NFELARNQKT SSQISMGFPR NCISWLDTLL QPSPSTHASH LPPRGQLVAS  360
VDACGPSDAD RIFPLRSTAR ETRSRGNINS SDLMDLSAIA IAHCISTKQP NHKVGASRER  420
KKER*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A1e-24126191974Probable WRKY transcription factor 4
1wj2_A1e-24126191974Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.557620.0panicle| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154349250.0
Expression AtlasQ0JQ43-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g08710.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g08710
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3418530.0AY341853.1 Oryza sativa (japonica cultivar-group) WRKY12 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015632226.10.0PREDICTED: uncharacterized protein LOC4325330 isoform X1
TrEMBLQ0JQ430.0Q0JQ43_ORYSJ; Os01g0182700 protein
STRINGLOC_Os01g08710.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
MonocotsOGMP113838130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39410.17e-46WRKY DNA-binding protein 13