PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g08160.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 508aa    MW: 53021.6 Da    PI: 5.9487
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g08160.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.31.3e-31266321156
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                       k+r++W+peLH+rFv+a++ LGG+++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  LOC_Os01g08160.1 266 KARRCWSPELHRRFVNALQILGGAQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 321
                       68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.554263323IPR017930Myb domain
SuperFamilySSF466893.29E-17264324IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.5E-28264324IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-26266321IPR006447Myb domain, plants
PfamPF002491.1E-6268319IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 508 aa     Download sequence    Send to blast
MASSSSDLTL DDHHHLTAVA AASGQATQKL QEFLSRLEEE RLKIDAFKRE LPLCMQLLNH  60
AMEAYRQQLE AYQMGSQHSA AAAAAARAPL VLEEFIPVKN IGIDVVAADK AAAAGGNSVS  120
SEKASWMVSA QLWNAPASAS AADTAAKGPQ TPKEHSEHHP LDTSPKLITA LDGGGGGGGA  180
FLPFSKDNAM GDGSAAAAAA LPELALAPAE KAADAITIAA GEVDKKPYAH DNGVVARSRE  240
AQNGGKPPST PSDGQAVPPP PQPHRKARRC WSPELHRRFV NALQILGGAQ VATPKQIREL  300
MKVDGLTNDE VKSHLQKYRL HTRRPMPSPA PPTAATPQLV VLGGIWVPPE YATQAAGPAI  360
YGAHPATQPH YTAAVAAQEY YHHHHHHLQH HPAAAALVHH RAVAPPPPLP PQQQLAPPYS  420
AKSSASARLG SPDSDGRGSG GGGGAAASGA GRDMSESIEE EGEGEEREDD DDDDEMAATN  480
NAHAVDGDDD NDEINTTTTT SAGAINY*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.298190.0leaf| panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329950170.0
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g08160.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g08160
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1098080.0AK109808.1 Oryza sativa Japonica Group cDNA clone:002-147-G07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631343.10.0PREDICTED: uncharacterized protein LOC4326224 isoform X1
TrEMBLA0A0E0MS370.0A0A0E0MS37_ORYRU; Uncharacterized protein
STRINGLOC_Os01g08160.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP43031624
MonocotsOGMP97733338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.13e-40G2-like family protein