PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g07880.1
Common NameOSJNBa0089K24.18
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 204aa    MW: 21092 Da    PI: 10.607
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g07880.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_138.82e-12109169262
                       XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                       ke  r +r+ +NR++A+  R+RKka++ eLe k+k Le  N +L +++++l++e  +l++ 
  LOC_Os01g07880.1 109 KEQNRLKRLLRNRVSAQQARERKKAYMTELEAKAKDLELRNAELEQRVSTLQNENNTLRQI 169
                       78899***************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.6E-13108172IPR004827Basic-leucine zipper domain
PfamPF001707.5E-11109170IPR004827Basic-leucine zipper domain
PROSITE profilePS5021712.185110173IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.19E-12113170No hitNo description
CDDcd147047.03E-15113163No hitNo description
Gene3DG3DSA:1.20.5.1701.3E-16113172No hitNo description
PROSITE patternPS000360115130IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MAAQEQEQEK QQVKTSTTSS LPSSSERSSS SAPNNLKEGG GVESDEEIRR VPEMGGGGGS  60
ASSGAGADER QGKEDGKQQG GGGGGAAAAG GGQEQAPPAR KRGRSAGDKE QNRLKRLLRN  120
RVSAQQARER KKAYMTELEA KAKDLELRNA ELEQRVSTLQ NENNTLRQIL KNTTAHAGKR  180
GGGGGGKGGD GGGGGKKHHF TKS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1184192GGKGGDGGG
2186195KGGDGGGGGK
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ5VR11
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g07880.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g07880
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0032150.0AP003215.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:OSJNBa0089K24.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015617496.11e-139PREDICTED: transcription factor HY5
SwissprotQ9SM504e-47HY5_SOLLC; Transcription factor HY5
TrEMBLA0A0E0MS141e-139A0A0E0MS14_ORYRU; Uncharacterized protein
TrEMBLQ0JQA41e-139Q0JQA4_ORYSJ; Os01g0174000 protein
TrEMBLQ5VR111e-138Q5VR11_ORYSJ; Putative TGACG-motif binding factor
STRINGLOC_Os01g07880.11e-139(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP20811737
MonocotsOGMP140838111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11260.11e-33bZIP family protein