PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g07480.1
Common NameCRLL4, LOC4325196, OJ1276_B06.29, Os01g0169400, OSNPB_010169400, P0028E10.30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family LBD
Protein Properties Length: 252aa    MW: 25728.1 Da    PI: 7.7814
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g07480.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260141.82.2e-44301291100
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       +CaaCk+lrrkC ++Cv+apyfp e+p+kfanvhk+FGasnv+kll++l +++reda+ssl+yeAear++dPvyG+vg i+ lq+q+++l++e
  LOC_Os01g07480.1  30 PCAACKFLRRKCLPGCVFAPYFPPEEPQKFANVHKVFGASNVTKLLNELLPHQREDAVSSLAYEAEARVKDPVYGCVGAISVLQRQVHRLQKE 122
                       7******************************************************************************************** PP

            DUF260  94 lallkee 100
                       l+++++e
  LOC_Os01g07480.1 123 LDTAHAE 129
                       **99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.42729130IPR004883Lateral organ boundaries, LOB
PfamPF031959.7E-4430127IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MASSSSTSNS AISSVVASAV ATTTPGAGSP CAACKFLRRK CLPGCVFAPY FPPEEPQKFA  60
NVHKVFGASN VTKLLNELLP HQREDAVSSL AYEAEARVKD PVYGCVGAIS VLQRQVHRLQ  120
KELDTAHAEL LRYACGEVGI PTALPVTAAP RLAAAMPAPG QLAAAVSAGM YGGGRRLGVI  180
DGGGIAPPSP HTAGCYYARN NNAGSIGADV APVLPYASVA NWTVNAISTT TTNSGSESIG  240
MDHKEGGDSS M*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.182800.0panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329907360.0
Expression AtlasQ9AS62-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00581DAPTransfer from AT5G63090Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g07480.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g07480
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0033390.0AP003339.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:OJ1276_B06.
GenBankAP0029120.0AP002912.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0028E10.
GenBankAB2002380.0AB200238.1 Oryza sativa Japonica Group CRLL4 mRNA for LOB domain protein, complete cds.
GenBankAK1055270.0AK105527.1 Oryza sativa Japonica Group cDNA clone:001-127-G05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648000.10.0PREDICTED: protein LATERAL ORGAN BOUNDARIES
RefseqXP_015648006.10.0PREDICTED: protein LATERAL ORGAN BOUNDARIES
RefseqXP_015648013.10.0PREDICTED: protein LATERAL ORGAN BOUNDARIES
SwissprotQ9FML43e-68LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLQ9AS620.0Q9AS62_ORYSJ; LOB domain protein
STRINGLOC_Os01g07480.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
MonocotsOGMP88133545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.42e-67LBD family protein
Publications ? help Back to Top
  1. Inukai Y, et al.
    Crown rootless1, which is essential for crown root formation in rice, is a target of an AUXIN RESPONSE FACTOR in auxin signaling.
    Plant Cell, 2005. 17(5): p. 1387-96
    [PMID:15829602]