PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g07430.1
Common NameOsJ_00530
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 244aa    MW: 26057.4 Da    PI: 5.3765
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g07430.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.75.6e-135089445
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                       +  E e ++ + k+lG++ W+ Ia++m+ gRt++++k++w+
  LOC_Os01g07430.1 50 ISDREAETILSLQKLLGNR-WSVIAAKMP-GRTDNEIKNYWN 89
                      577899*************.*********.***********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.6941IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.609.3E-62340IPR009057Homeodomain-like
SuperFamilySSF466893.08E-192797IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-214195IPR009057Homeodomain-like
PROSITE profilePS5129420.2934296IPR017930Myb domain
SMARTSM007175.6E-124694IPR001005SANT/Myb domain
CDDcd001677.21E-94989No hitNo description
PfamPF002491.2E-105190IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MLIARQVIWF LDLTRLALHS FHCAGLRRSG KSCRLRWMNY LRPDLKKEPI SDREAETILS  60
LQKLLGNRWS VIAAKMPGRT DNEIKNYWNS RIRKRQSAAA GAKGEPAPAT VMEKEPTANA  120
ATVAAAPEAA SPPPPPIPAR LPMFSCQLLD GGGSGGATAT TQSPPNAGSS DISEVSACGG  180
NGGGEDSSRD YCFSGGDVDG DGDMVHLLAL DDLDLLVDVP GLLDVDAWDC ELYRADYSTS  240
RAR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-18229536107B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasA2ZPP9
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g07430.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g07430
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY4593430.0AY459343.1 Oryza sativa (japonica cultivar-group) clone CL018501.1 R2R3-MYB gene region.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0033390.0AP003339.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:OJ1276_B06.
GenBankAP0029120.0AP002912.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0028E10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645714.11e-160PREDICTED: myb-related protein Hv33-like
TrEMBLA2ZPP91e-179A2ZPP9_ORYSJ; Uncharacterized protein
STRINGLOC_Os01g07430.11e-179(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP87032545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12350.19e-31myb domain protein 42