PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g06320.1
Common NameLOC4324082, Os01g0156000, OsJ_00436, OSNPB_010156000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 307aa    MW: 34110.5 Da    PI: 6.5116
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g06320.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding569.1e-183276147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      r rW++eE+e+++da  ++G + Wk+I +++g ++t  q++s+ qky
  LOC_Os01g06320.1 32 RERWSEEEHERFLDALIMYGRD-WKKIEEHVG-TKTTIQIRSHAQKY 76
                      78******************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.87E-182682IPR009057Homeodomain-like
PROSITE profilePS5129420.7692781IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.9E-92983IPR009057Homeodomain-like
TIGRFAMsTIGR015575.8E-183079IPR006447Myb domain, plants
SMARTSM007171.3E-123179IPR001005SANT/Myb domain
PfamPF002492.2E-143276IPR001005SANT/Myb domain
CDDcd001671.95E-103477No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009030anatomycarpel
PO:0007130developmental stagesporophyte reproductive stage
PO:0007606developmental stagegynoecium development stage
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MDRNTNNNSN SSSSSEMPGK KARKPYTITK PRERWSEEEH ERFLDALIMY GRDWKKIEEH  60
VGTKTTIQIR SHAQKYFLKV QKMGLAAGLP PQYPRRRLVM QQQQQQSSPA VSSSVAATAI  120
LHGQPQCLPP HHNVAVQSSI GWECPGVLPP ATNDMQNLEW ASTSGTAAWG NHHGLIEPPA  180
AFVSFPGESS FMGAASFSNT SMDWTGTTSE MATASIVQDE TIELPLSPDD LQFAQVYRFI  240
GDIFDPDSPC PVETHLQKLK SMDDIIVKTI LLVLRNLEDN LLSPQFEPIR RLLSTYDPNR  300
GLSGHL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.316520.0panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329921780.0
Expression AtlasQ0JQJ6-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g06320.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g06320
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1069690.0AK106969.1 Oryza sativa Japonica Group cDNA clone:002-119-G02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646001.10.0PREDICTED: protein REVEILLE 8
TrEMBLQ0JQJ60.0Q0JQJ6_ORYSJ; Os01g0156000 protein
STRINGLOC_Os01g06320.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9281558
MonocotsOGMP36423170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09600.12e-46MYB_related family protein