PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g04930.1
Common NameLOC4325454, Os01g0142500, OsJ_00326, OSNPB_010142500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 295aa    MW: 32501.6 Da    PI: 9.796
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g04930.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.11.1e-092873347
                      SS-HHHHHHHHHHHHHTTTT..-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  3 rWTteEdellvdavkqlGgg..tWktIartmgkgRtlkqcksrwqky 47
                      +W++eE +++ +a + l  +  +W+++ar ++ gR++ ++ ++++++
  LOC_Os01g04930.1 28 KWSPEENKQFERALAGLDLRcpDWDRVARAIP-GRSALEVMNHFRDL 73
                      8*****************99************.***********976 PP

2Myb_DNA-binding48.12.6e-15141185347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +WT+eE++l++ + k++G+g+W+ I+r + ++Rt+ q+ s+ qky
  LOC_Os01g04930.1 141 PWTEEEHKLFLLGLKKYGKGDWRNISRNFVQTRTPTQVASHAQKY 185
                       8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007177.5E-52576IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.8E-52772IPR009057Homeodomain-like
PROSITE profilePS500906.2842874IPR017877Myb-like domain
CDDcd001671.13E-72873No hitNo description
SuperFamilySSF466892.99E-82881IPR009057Homeodomain-like
PfamPF002493.8E-82873IPR001005SANT/Myb domain
PROSITE profilePS5129418.359134190IPR017930Myb domain
SuperFamilySSF466896.8E-18135190IPR009057Homeodomain-like
TIGRFAMsTIGR015575.7E-17137188IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.3E-12138184IPR009057Homeodomain-like
SMARTSM007173.4E-13138188IPR001005SANT/Myb domain
CDDcd001677.66E-12141186No hitNo description
PfamPF002499.9E-13141185IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MMMRDVCMEV LPPMDHYASR GNWFMARKWS PEENKQFERA LAGLDLRCPD WDRVARAIPG  60
RSALEVMNHF RDLELDVQQI ENGMVPFPVY GAAAAGGAFT LQWDGAHGVG DFRNAYRFGG  120
GGGGKRHFGR TPEQERKKGV PWTEEEHKLF LLGLKKYGKG DWRNISRNFV QTRTPTQVAS  180
HAQKYFIRLN SGGKDKRRSS IHDITTVNLT DDRPPSPSQS SLISNQSNTS TLTAAVAPFS  240
STADVKPQNA ANASFNSPSR TLGMAGYGMG LQDQGLQCGG PLHDQLAASR SILF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-131890373RADIALIS
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.16190.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329779820.0
Expression AtlasQ0JQS2-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g04930.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g04930
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU8372500.0EU837250.1 Oryza sativa Japonica Group clone KCB707G04 myb transcription factor mRNA, complete cds.
GenBankAK0679640.0AK067964.1 Oryza sativa Japonica Group cDNA clone:J013124L02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015621817.10.0PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H72e-83DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLQ0JQS20.0Q0JQS2_ORYSJ; MYB transcription factor
STRINGLOC_Os01g04930.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78863348
Representative plantOGRP27517122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.12e-64MYB family protein