PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g03720.1
Common NameLOC4325992, Os01g0128000, OsJ_00224, OSNPB_010128000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 351aa    MW: 38488.3 Da    PI: 6.5036
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g03720.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.52.7e-173077148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+WT eEd ll ++++ +G g+W++ ar+ g++Rt+k+c++rw++yl
  LOC_Os01g03720.1 30 RGPWTLEEDNLLMNYIACHGEGRWNLLARCSGLKRTGKSCRLRWLNYL 77
                      89********************************************97 PP

2Myb_DNA-binding52.79.5e-1783126146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg+ T+eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  LOC_Os01g03720.1  83 RGNLTPEEQLLILELHSRWGNR-WSRIAQHLP-GRTDNEIKNYWRT 126
                       7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.8852577IPR017930Myb domain
SuperFamilySSF466899.36E-3127124IPR009057Homeodomain-like
SMARTSM007171.2E-132979IPR001005SANT/Myb domain
PfamPF002496.0E-153077IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-233184IPR009057Homeodomain-like
CDDcd001674.41E-113277No hitNo description
PROSITE profilePS5129425.5878132IPR017930Myb domain
SMARTSM007175.1E-1582130IPR001005SANT/Myb domain
PfamPF002491.3E-1583126IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2385131IPR009057Homeodomain-like
CDDcd001674.03E-1287126No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009686Biological Processgibberellin biosynthetic process
GO:0009751Biological Processresponse to salicylic acid
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MSQRRVAGPM GVMSKQQQEA MAEEMMELRR GPWTLEEDNL LMNYIACHGE GRWNLLARCS  60
GLKRTGKSCR LRWLNYLKPD IKRGNLTPEE QLLILELHSR WGNRWSRIAQ HLPGRTDNEI  120
KNYWRTRVQK QARQLKVDAN STVFRDAVRC YWMPRLLEKM AGAATDPTPP PPPPLHHHAA  180
MATASSSPFD FDTHLQQAEA ATACVVPNNV YHHHIDPSPS TSTSAGSTAA AAAFQPLPCF  240
SELRWDQQMQ SSGELDDGAA GVFVDSASAL GSLSLDGLDL GPAEYYSDST LLDYLNSSCT  300
GSAMMTMMTA SGNAGSYNYC GGAMDGGDTW RSDEVCQAAA RKLGEWGGGI *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A6e-27271311104MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ0JR06
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00216DAPTransfer from AT1G68320Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g03720.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g03720
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1074240.0AK107424.1 Oryza sativa Japonica Group cDNA clone:002-127-F10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015633684.10.0PREDICTED: transcription factor MYB108 isoform X1
TrEMBLA0A0E0MQW30.0A0A0E0MQW3_ORYRU; Uncharacterized protein
TrEMBLQ0JR060.0Q0JR06_ORYSJ; Os01g0128000 protein
STRINGLOC_Os01g03720.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.18e-78myb domain protein 62