PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g01470.1
Common NameLOC4326295, Os01g0104500, OsJ_00037, OSNPB_010104500, P0436E04.23
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 321aa    MW: 35726.6 Da    PI: 6.7133
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g01470.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.32.1e-55141421128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                       lppGfrFhPtdee++++yL++kv +++  +  +i evd++k+ePwdLp k+  ++ekewyf++++d+ky+tg r+nrat++gyWkatgkdke+
  LOC_Os01g01470.1  14 LPPGFRFHPTDEEIITFYLAPKVVDSRGFCVAAIGEVDLNKCEPWDLPgKAKMNGEKEWYFYCQKDRKYPTGMRTNRATEAGYWKATGKDKEI 106
                       79********************99999556588***************544445788************************************ PP

               NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       ++ ++ l+g+kktLvfykgrapkg kt+Wvmheyrl
  LOC_Os01g01470.1 107 FRDHHMLIGMKKTLVFYKGRAPKGDKTNWVMHEYRL 142
                       **9*******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-6210170IPR003441NAC domain
PROSITE profilePS5100559.60314170IPR003441NAC domain
PfamPF023653.2E-2815142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MGEQQQQVER QPDLPPGFRF HPTDEEIITF YLAPKVVDSR GFCVAAIGEV DLNKCEPWDL  60
PGKAKMNGEK EWYFYCQKDR KYPTGMRTNR ATEAGYWKAT GKDKEIFRDH HMLIGMKKTL  120
VFYKGRAPKG DKTNWVMHEY RLADASPPPP PSSAEPPRQD DWAVCRIFHK SSGIKKPVPV  180
APHQVPAAAN YQQQQQMAMA SAGIIQVPMQ MQMPSMSDQL QMLDDFSTTA SLSLMAPPSY  240
STLPAGFPLQ INSGAHPQQF VGNPSMYYHQ QQQMDMAGGG FVVSEPSSLV VSPQDAADQN  300
NNAADISSMA CNMDAAIWKY *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-5211764171NO APICAL MERISTEM PROTEIN
1ut4_B2e-5211764171NO APICAL MERISTEM PROTEIN
1ut7_A2e-5211764171NO APICAL MERISTEM PROTEIN
1ut7_B2e-5211764171NO APICAL MERISTEM PROTEIN
3swm_A2e-5211767174NAC domain-containing protein 19
3swm_B2e-5211767174NAC domain-containing protein 19
3swm_C2e-5211767174NAC domain-containing protein 19
3swm_D2e-5211767174NAC domain-containing protein 19
3swp_A2e-5211767174NAC domain-containing protein 19
3swp_B2e-5211767174NAC domain-containing protein 19
3swp_C2e-5211767174NAC domain-containing protein 19
3swp_D2e-5211767174NAC domain-containing protein 19
4dul_A2e-5211764171NAC domain-containing protein 19
4dul_B2e-5211764171NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.135480.0panicle| seed
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ9FTY0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g01470.1
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g01470
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9443650.0JN944365.1 Oryza sativa Japonica Group clone KCS263E06 NAM protein mRNA, complete cds.
GenBankGU1203530.0GU120353.1 Oryza sativa Japonica Group clone KCS385F08 NAM protein mRNA, complete cds.
GenBankAK2422680.0AK242268.1 Oryza sativa Japonica Group cDNA, clone: J075186C19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015621005.10.0PREDICTED: NAC domain-containing protein 92
SwissprotQ9FLR33e-78NAC79_ARATH; NAC domain-containing protein 79
TrEMBLQ9FTY00.0Q9FTY0_ORYSJ; NAM protein
STRINGLOC_Os01g01470.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP145237121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.22e-78Arabidopsis NAC domain containing protein 87