PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA037707-PA
Common NameOsI_38946
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family B3
Protein Properties Length: 354aa    MW: 40498.9 Da    PI: 8.6755
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA037707-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B347.43.5e-15381141494
                       T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
                B3  14 grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                       + +++p k ae ++g+ ++     l+++sg++W+v +   k  ++ +l++GW++F+ka++L+e+D + F+ +g+ ++++ +
  BGIOSGA037707-PA  38 HGISIPEKVAEIFSGQITK--GFNLKSPSGETWRVGV--AKVADELILKSGWEDFAKAHELQENDLLFFTCNGHGNGSCSF 114
                       459*******777777555..59999***********..*******************************77665554443 PP

2B348.41.7e-15247344198
                       EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEE.TTS-EEEEEE...EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE CS
                B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltled.esgrsWevkliy.rkksgryvltkGWkeFvkangLkegDfvvFkldgr.sef 90 
                       f+ vl +++v ++++l++p +fa++h +   +s ++ l    + ++W+vk+ y +++ +++     W +F ++n+L+eg +++F+l++  ++ 
  BGIOSGA037707-PA 247 FVVVLQTAHVRRRNILIVPTRFAADHLER--KSHDILLIRpNRKQKWSVKYYYlSNTTRGFNCH-RWIKFIRENRLREGNVCIFELMKGaRRP 336
                       788999********************544..45567776636779******8865555555544.8*******************99776888 PP

                       ..EEEEE- CS
                B3  91 elvvkvfr 98 
                       +++v+v+ 
  BGIOSGA037707-PA 337 TMTVHVIG 344
                       89999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.32E-1821124IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.06925122IPR003340B3 DNA binding domain
CDDcd100173.77E-1427120No hitNo description
Gene3DG3DSA:2.40.330.107.8E-1828124IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.4E-628122IPR003340B3 DNA binding domain
PfamPF023621.7E-1237112IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.3E-18240344IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.06E-21241342IPR015300DNA-binding pseudobarrel domain
CDDcd100172.01E-18245341No hitNo description
PROSITE profilePS5086313.225247346IPR003340B3 DNA binding domain
PfamPF023622.8E-13247344IPR003340B3 DNA binding domain
SMARTSM010197.9E-10247346IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005773Cellular Componentvacuole
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MGEKGCESCR KWQEHYYREH MDVSRIRFFR LMTGDFAHGI SIPEKVAEIF SGQITKGFNL  60
KSPSGETWRV GVAKVADELI LKSGWEDFAK AHELQENDLL FFTCNGHGNG SCSFDVLIFD  120
ASGCEKVSCF FTGKKNSYMC KNFNSIGGQV AGQYLSSDSE DTSTPSVLIG SPHKASTSKK  180
LSGKTKTNPR KEPEDPNCSH WHVIEEKNTD DDEHADYHYT RFANYLTGEE RDEIFSLVSL  240
QPGNPVFVVV LQTAHVRRRN ILIVPTRFAA DHLERKSHDI LLIRPNRKQK WSVKYYYLSN  300
TTRGFNCHRW IKFIRENRLR EGNVCIFELM KGARRPTMTV HVIGKADNRF VLLG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00468DAPTransfer from AT4G33280Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126200.0CP012620.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 12 sequence.
GenBankAP0149680.0AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
GenBankAL9548290.0AL954829.6 Oryza sativa chromosome 12, . BAC OSJNBa0044E20 of library OSJNBa from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619308.10.0PREDICTED: LOW QUALITY PROTEIN: B3 domain-containing protein LOC_Os12g40090-like
SwissprotQ2QMT50.0Y1209_ORYSJ; B3 domain-containing protein LOC_Os12g40090
TrEMBLA0A0D3HWA30.0A0A0D3HWA3_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0GVZ80.0A0A0E0GVZ8_ORYNI; Uncharacterized protein
TrEMBLA0A0E0RJF40.0A0A0E0RJF4_ORYRU; Uncharacterized protein
TrEMBLA2ZM930.0A2ZM93_ORYSI; Putative uncharacterized protein
TrEMBLI1R7J70.0I1R7J7_ORYGL; Uncharacterized protein
STRINGBGIOSGA037707-PA0.0(Oryza sativa Indica Group)
STRINGORGLA12G0150300.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56234179
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G33280.12e-29B3 family protein