PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA037646-PA
Common NameOsI_38826
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRAS
Protein Properties Length: 712aa    MW: 79517.2 Da    PI: 6.8803
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA037646-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS360.72e-1103327041374
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                       l++lL++cA+av+++d + a++lL++++++a p+gd++qRla++f+e+L+ar+a+++s + ++l +++ts    ++ l+a++l+  +  + k+
  BGIOSGA037646-PA 332 LRTLLIHCAQAVATDDRRSATELLKQIKQHAKPTGDATQRLAHCFAEGLQARIAGTGSLVHQSLVAKRTS---AVDILQAYQLYMAAICFKKV 421
                       6789***************************************************999999999999998...9******************* PP

              GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvak 184
                       s++  Nq+I++a  g++++Hi+D++i++G+QWp++l+ +++R++gpp++R+Tg++ p++g   +e++eetg+rL+k+A+e+gvpf++n+++a 
  BGIOSGA037646-PA 422 SFIFSNQTIYNASLGKKKIHIVDYGIQYGFQWPCFLRRISQREGGPPEVRMTGIDLPQPGfrPTERIEETGHRLSKYAQEFGVPFKYNAIAAV 514
                       ***********************************************************9*****************************9999 PP

              GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                       ++e+++ e+L+++p+E+l+Vn+++q ++l+desv ++s+rd vL+ +++++P+v++++  + + +++ F++rf eal +ysalfd l+a+ pr
  BGIOSGA037646-PA 515 KMESVRKEDLNIDPDEVLIVNCQYQFKNLMDESVVIDSPRDIVLSNIRKMQPHVFIHAIVNGSFSAPFFVTRFREALFFYSALFDVLDATTPR 607
                       ********************************************************************************************* PP

              GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsv 370
                       ese+r  +E+ ++gr++ nv+aceg +r+er et+++W+ r ++aGFk++pl+ ++++ ++  ++ ++ + + ++ ++++l++gWk+r L+++
  BGIOSGA037646-PA 608 ESEQRLLIEQNIFGRAALNVIACEGIDRVERPETYKQWQVRNQRAGFKQLPLNPEIVQVVRNKVKDCYHKDFVIDIDHQWLLQGWKGRILYAI 700
                       ********************************************************************889********************** PP

              GRAS 371 SaWr 374
                       S W+
  BGIOSGA037646-PA 701 STWT 704
                       ***5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.733306684IPR005202Transcription factor GRAS
PfamPF035147.1E-108332704IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 712 aa     Download sequence    Send to blast
MGSSAADSFP AGGDDAIRDV YGIGGGGEED DPSLFLYLSD LAPVSPSAYL DLPPSPPPPT  60
TTATTMVKEG EEAPEDLVLP FISRMLMEED IDDKFFYDYP DNPALLQAQQ PFLEILSDPS  120
SNSRSSNSDD PRLSPTSSSD TIRRHQLLRR RRHRHRRCRR RGARAAGMEE ANKFLPTENK  180
LVIDLEASSE NNYLRGLEEA KRFLPSDDKL QVGFAAAAAP VVSVKKEAVD VVVATASGGG  240
GRGRKNPYDD EELELEGGRS SKQTAVQGDD VAARAMFDKV MMTSHENCTE MMEKLRIAMK  300
EEAAKNEASA GGKGGNGKVK GGRRGGRDVV DLRTLLIHCA QAVATDDRRS ATELLKQIKQ  360
HAKPTGDATQ RLAHCFAEGL QARIAGTGSL VHQSLVAKRT SAVDILQAYQ LYMAAICFKK  420
VSFIFSNQTI YNASLGKKKI HIVDYGIQYG FQWPCFLRRI SQREGGPPEV RMTGIDLPQP  480
GFRPTERIEE TGHRLSKYAQ EFGVPFKYNA IAAVKMESVR KEDLNIDPDE VLIVNCQYQF  540
KNLMDESVVI DSPRDIVLSN IRKMQPHVFI HAIVNGSFSA PFFVTRFREA LFFYSALFDV  600
LDATTPRESE QRLLIEQNIF GRAALNVIAC EGIDRVERPE TYKQWQVRNQ RAGFKQLPLN  660
PEIVQVVRNK VKDCYHKDFV IDIDHQWLLQ GWKGRILYAI STWTPNDALS YF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-443367038374GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.142500.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379915660.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126200.0CP012620.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 12 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620149.10.0PREDICTED: scarecrow-like protein 34
TrEMBLA2ZLX00.0A2ZLX0_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA037646-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-164GRAS family protein