PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA036923-PA
Common NameMIF2, OsI_37313
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family ZF-HD
Protein Properties Length: 105aa    MW: 10817.9 Da    PI: 8.0589
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA036923-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer101.17.9e-323187259
       ZF-HD_dimer  2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
                      + vrY+eC++NhAas+GghavDGC+Efm+s g++gtaaal CaACgCH +FHRreve 
  BGIOSGA036923-PA 31 KVVRYRECQRNHAASIGGHAVDGCREFMAS-GADGTAAALLCAACGCHQSFHRREVEA 87
                      579**************************9.999*********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257746.0E-123199IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.4E-303385IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.4E-263485IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.2943584IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005737Cellular Componentcytoplasm
GO:0046872Molecular Functionmetal ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 105 aa     Download sequence    Send to blast
MGPQQDRSAA KPYANGSTAA AAAAGRKENN KVVRYRECQR NHAASIGGHA VDGCREFMAS  60
GADGTAAALL CAACGCHQSF HRREVEAAAA ECDCSSDTSS GTGRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.167841e-171leaf| panicle| seed| stem
Functional Description ? help Back to Top
Source Description
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2879801e-178AK287980.1 Oryza sativa Japonica Group cDNA, clone: J075083D24, full insert sequence.
GenBankAP0149681e-178AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
GenBankBX0004951e-178BX000495.1 Oryza sativa chromosome 12, . BAC OSJNBb0119L20 of library OSJNBb from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankBX0005091e-178BX000509.2 Oryza sativa chromosome 12, . BAC OJ1085_G07 of library Monsanto from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620648.14e-70mini zinc finger protein 2
SwissprotB8BLT34e-71MIF2_ORYSI; Mini zinc finger protein 2
SwissprotB9GBM34e-71MIF2_ORYSJ; Mini zinc finger protein 2
TrEMBLA0A0D3HHP13e-67A0A0D3HHP1_9ORYZ; Uncharacterized protein
TrEMBLI1QXA23e-67I1QXA2_ORYGL; Uncharacterized protein
STRINGOS12T0124500-012e-69(Oryza sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143134120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.11e-18mini zinc finger 2