PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA035745-PA
Common NameOsI_37092
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRAS
Protein Properties Length: 593aa    MW: 66589 Da    PI: 6.6751
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA035745-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS286.57.2e-882145832373
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       + lL++cA+a ++++++ a +lL++++++a  +gd+mqR+a+yf+++L+arla+ +++ly+     ++ +++ +e l+++kl+  ++ + k++
  BGIOSGA035745-PA 214 RLLLIQCAQATATDNQQSAGELLKKIKQHALATGDAMQRVAHYFAKGLEARLAGRGKHLYQ-----NQMRMSLVEYLKVYKLYMAACCFTKVA 301
                       568***************************************************9999994.....33446699******************* PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                        + a  +I++av+g++r+Hi+D++   Gl+Wp Ll+ L sR++gpp++RiT v+   +     +++ee g+ L++ A+e++vpf+f++++a +
  BGIOSGA035745-PA 302 LMFAAMTIMQAVQGKKRLHIVDYGPRCGLHWPDLLRRLGSREDGPPEVRITIVDILLPAfrPFQRIEEAGHCLSSCANEFRVPFRFQAVAAAK 394
                       *****************************************************997777789**************************9999* PP

              GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklp 276
                       +e++  e+L++kp+E+l+Vn  l+   l+desv  +   +rd  L+ + +++P+v++    + ++ ++sFl rf   l yysalfd l+a+ p
  BGIOSGA035745-PA 395 WETVGAEDLHIKPDEVLVVNDLLSFSALMDESVFCDGpnPRDVALRNISKMQPDVFIQGITNDSY-GASFLSRFRAVLLYYSALFDILDATTP 486
                       ********************************98776669******************9999888.789************************ PP

              GRAS 277 reseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvs 369
                       r+s  r  +E+ llg+ + n++acega+ +er e++++W++r ++aG+++++l+ +++++++  ++k++ + + + e+ ++l++gW++r L++
  BGIOSGA035745-PA 487 RDSGLRLALEQNLLGPYALNAIACEGADLVERPEKYKQWQARNHRAGMQQLKLRPDIVDTIRDEVNKYHHKDFLLGEDGQWLLQGWMGRILFA 579
                       *********************************************************************888********************* PP

              GRAS 370 vSaW 373
                        SaW
  BGIOSGA035745-PA 580 HSAW 583
                       **** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098551.832187564IPR005202Transcription factor GRAS
PfamPF035142.5E-85214583IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 593 aa     Download sequence    Send to blast
MANPEDFFWE ALLKENEAPS PPPVFFDLPA TPLSNSDGTD PSSLDNQLLS YVSRMLMEDE  60
MGSSAAITNL QCVNRGSTEE ANNMLPGSEV VRAFSKGMGE ASKLLPRNNS FRTLEAVDQV  120
SSDGHCRGRK KKNHDRDEQQ LEEELGRSSK LAALTIAGTQ EAGARELLDE LMLHAHETCI  180
KDMEKLRIDM DNEAEKKINK KDKKGSSSKV VDLRLLLIQC AQATATDNQQ SAGELLKKIK  240
QHALATGDAM QRVAHYFAKG LEARLAGRGK HLYQNQMRMS LVEYLKVYKL YMAACCFTKV  300
ALMFAAMTIM QAVQGKKRLH IVDYGPRCGL HWPDLLRRLG SREDGPPEVR ITIVDILLPA  360
FRPFQRIEEA GHCLSSCANE FRVPFRFQAV AAAKWETVGA EDLHIKPDEV LVVNDLLSFS  420
ALMDESVFCD GPNPRDVALR NISKMQPDVF IQGITNDSYG ASFLSRFRAV LLYYSALFDI  480
LDATTPRDSG LRLALEQNLL GPYALNAIAC EGADLVERPE KYKQWQARNH RAGMQQLKLR  540
PDIVDTIRDE VNKYHHKDFL LGEDGQWLLQ GWMGRILFAH SAWVRQSQDT SSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-292175838374GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1235240LKKIKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.147620.0callus| flower| leaf| panicle| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379906080.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126190.0CP012619.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 11 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616387.10.0PREDICTED: scarecrow-like protein 9
TrEMBLA2ZH290.0A2ZH29_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA035745-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29065.11e-111GRAS family protein