PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA035744-PA
Common NameOsI_37091
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRAS
Protein Properties Length: 595aa    MW: 66648.1 Da    PI: 6.5122
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA035744-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS298.61.6e-912165852373
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       + lL++cA+a+++++++ a +lL++++++a  +gd+mqR+a+yf+++L+arla+s+++ly+  +     +++ +e l+++kl+  ++ + k++
  BGIOSGA035744-PA 216 RMLLIQCAQAMATDNQQSAGELLKKIKQHALATGDAMQRVAHYFAKGLEARLAGSGKHLYQ--NHV---RMSLVEYLKVYKLYMAACCFKKVA 303
                       679*********************************************************5..233...34489******************* PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                        + a  +I++av+g++r+Hi+D++i  Gl+Wp L++ L sR++gpp++RiT v+ p++g    + +e+ g+ L++ A++++vpf+f+++va +
  BGIOSGA035744-PA 304 LMFAAMTIMQAVQGKKRLHIVDYGIRCGLHWPDLFRRLGSREDGPPEVRITIVDIPQPGfrPFQHIEAAGHCLSSCANKFRVPFRFQAVVAAK 396
                       **********************************************************99999****************************** PP

              GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklp 276
                       +e++  e+L+++p+E+l+Vn   +   l+desv  +   +rd  L+ + +++P+v++    + ++ ++sFl rf  al yysalfd+l+a+ p
  BGIOSGA035744-PA 397 WETVGAEDLHIEPDEVLVVNDLWSFSALMDESVFCDGpnPRDVALRNISKMQPDVFIQGIINGSY-GASFLSRFRGALLYYSALFDMLDATTP 488
                       ********************************98776669************************9.789************************ PP

              GRAS 277 reseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvs 369
                       res  r  +E+ +lg+ + n++acega+ +er e++++W++r ++aG+++++l+ +++++++  ++k++ + + + e+ ++l++gW++r L++
  BGIOSGA035744-PA 489 RESGLRLALEQNVLGPYALNAIACEGADLVERPEKYRQWQARNHRAGMQQLKLRPDIVDTIREEVNKYHHKDFLLGEDGQWLLQGWMGRVLFA 581
                       *********************************************************************888********************* PP

              GRAS 370 vSaW 373
                        SaW
  BGIOSGA035744-PA 582 HSAW 585
                       **** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098552.332189566IPR005202Transcription factor GRAS
PfamPF035145.6E-89216585IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 595 aa     Download sequence    Send to blast
MANPEDFFWE ALLKENEAPS PSPVFFELPP TPLANSDGST DPSSLLDNQL LSYVSSMLME  60
DEMGSSAAVT NLQCVNRGST EEANNMLPGS EVVRAFLKGM EEASKLLPRN NSFRMLETVD  120
QVSSHGHCRG GKKKNHDRDE QQLEEELGRS SKLAAMTNAG TEEAGARELL DELMLHSHET  180
CIKDMEKLRI DMDNEADKTI KKKGKKGSSS KVVDLRMLLI QCAQAMATDN QQSAGELLKK  240
IKQHALATGD AMQRVAHYFA KGLEARLAGS GKHLYQNHVR MSLVEYLKVY KLYMAACCFK  300
KVALMFAAMT IMQAVQGKKR LHIVDYGIRC GLHWPDLFRR LGSREDGPPE VRITIVDIPQ  360
PGFRPFQHIE AAGHCLSSCA NKFRVPFRFQ AVVAAKWETV GAEDLHIEPD EVLVVNDLWS  420
FSALMDESVF CDGPNPRDVA LRNISKMQPD VFIQGIINGS YGASFLSRFR GALLYYSALF  480
DMLDATTPRE SGLRLALEQN VLGPYALNAI ACEGADLVER PEKYRQWQAR NHRAGMQQLK  540
LRPDIVDTIR EEVNKYHHKD FLLGEDGQWL LQGWMGRVLF AHSAWVPQQQ DNSSG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-322195858374GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1237242LKKIKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.147620.0callus| flower| leaf| panicle| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379906080.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126190.0CP012619.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 11 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616386.10.0PREDICTED: scarecrow-like protein 9
TrEMBLA2ZH280.0A2ZH28_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA035744-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-119SCARECROW-like 14