PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA035742-PA
Common NameOsI_37089
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRAS
Protein Properties Length: 481aa    MW: 53220.8 Da    PI: 4.6931
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA035742-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS214.46.1e-662294732242
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                        +lL++cA+av++gd + a++lL+++++++s +gd++qR+a +f+e+L+arla+++s++y++l +++ts   +++ l+a+klf  ++ i k+s
  BGIOSGA035742-PA 229 HTLLIHCAQAVATGDWRSATELLKQIKQNSSARGDATQRMACCFAEGLEARLAGTGSQMYQSLVAKRTS---TVDFLKAYKLFTAACCIKKVS 318
                       679************************************************************999999...8******************** PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                        +  N++I++av+g +++Hi+D+++s+G+QWpaL+  L +R++gpp++R+Tg++ p++g   ++++eetg+rL+  A+++gvpf+f++ +a +
  BGIOSGA035742-PA 319 VIFSNKTIYNAVAGRRKLHIVDYGLSYGFQWPALFFLLGAREGGPPEVRMTGIDVPQPGfrPADQIEETGRRLSICARQFGVPFKFRA-IAAK 410
                       **********************************************************9*****************************.799* PP

              GRAS 186 ledleleeLrvkp....gEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvv 242
                       +e+++ e+L+++p    +E+l+Vn+ + l +l desv ++s  +rd vL+ +++++P+v+v +
  BGIOSGA035742-PA 411 WETVRREDLHLDPeeeeEEVLVVNCLHGLNTLQDESVVVDSpsPRDVVLDNIRDMRPHVFVQC 473
                       ************9999999*****************98888779****************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.489202481IPR005202Transcription factor GRAS
PfamPF035142.1E-63229473IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 481 aa     Download sequence    Send to blast
MAAAPKPEEL VVAIEQPFSP SLFLDLPPTP HHDDDPNNVN DDLLLPFISR ILMEDDIDDK  60
FFYQFPDHPA LLQAQQSYAQ ILHAPATSSS SDDTTINNNT TNSTSVPDTL AMPDHDADTQ  120
SAPDDMEMLN MAFLKGREEA TNGGGRGRKN RHAEEDDLET ETSRSSKLMA PEHDDAAAAD  180
EIFDEIILNG YQMIIKGIDE LRVVMGSQSQ ADKNGRRASR AKTAVVDLHT LLIHCAQAVA  240
TGDWRSATEL LKQIKQNSSA RGDATQRMAC CFAEGLEARL AGTGSQMYQS LVAKRTSTVD  300
FLKAYKLFTA ACCIKKVSVI FSNKTIYNAV AGRRKLHIVD YGLSYGFQWP ALFFLLGARE  360
GGPPEVRMTG IDVPQPGFRP ADQIEETGRR LSICARQFGV PFKFRAIAAK WETVRREDLH  420
LDPEEEEEEV LVVNCLHGLN TLQDESVVVD SPSPRDVVLD NIRDMRPHVF VQCVVNGAYG  480
D
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-212324408216GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.878320.0callus| leaf| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329874080.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126190.0CP012619.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 11 sequence.
GenBankAC1370640.0AC137064.4 Oryza sativa Japonica Group cultivar Nipponbare chromosome 11 clone OSJNBb0003C04 map S10003, complete sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615829.10.0PREDICTED: scarecrow-like protein 9
TrEMBLB8BIL60.0B8BIL6_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA035742-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.12e-76GRAS family protein