PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA035741-PA
Common NameOsI_37088
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRAS
Protein Properties Length: 691aa    MW: 77143 Da    PI: 4.7814
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA035741-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS349.65e-1073046812373
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                        +lL++cA+av+++d + a++lL+++++++s +gd++qRla +f+e+L+arla+++s++yk+l ++ ts   +++ l+a+klf  ++ i k+s
  BGIOSGA035741-PA 304 HTLLIHCAQAVATSDRRSATELLKQIKQNSSARGDATQRLACCFAEGLEARLAGTGSQVYKSLVAKCTS---TVDFLKAYKLFAAACCIKKVS 393
                       679**************************************************************9999...8******************** PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                       ++  N++Il+av+g++++Hi+D+++s+G+QWp L++ L++R++gpp++RiTg++ p++g   ++++eetg+rL++ A+++gvpf+f++ +a +
  BGIOSGA035741-PA 394 FIFSNKTILDAVAGKRKLHIVDYGLSYGFQWPGLFKCLSEREGGPPEVRITGIDFPQPGfrPADQIEETGRRLSNCARQFGVPFRFQA-IAAK 485
                       **********************************************************9*****************************.799* PP

              GRAS 186 ledleleeLrvkp......gEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                       +e+++ e+L++++      +E+l+Vn+ + l +l desv ++s  +rd vL+ +++++P+v+v +  +  ++++ Fl+rf e+l +ys+ fd+
  BGIOSGA035741-PA 486 WETVRREDLHLDReeeeeeEEVLVVNCLHGLNTLQDESVVVDSpsPRDVVLNNIRDMRPHVFVQCVVNGAYGAPFFLTRFRETLFFYSSQFDM 578
                       *********999999999999*****************98888779*********************************************** PP

              GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWk 363
                       l+a++pr+++er  +Er +lgr + nv+acega+r+ r et+++W  r ++aG++++pl+ ++++ ++  ++k + + + ++ ++++l++gWk
  BGIOSGA035741-PA 579 LDATIPRDNDERLLIERDILGRCALNVIACEGADRVDRPETYKQWLVRNHRAGLTQLPLQPQVVELVRDKVKKLYHKDFVIDVDHNWLLQGWK 671
                       ***************************************************************************888*************** PP

              GRAS 364 drpLvsvSaW 373
                       +r L+++S W
  BGIOSGA035741-PA 672 GRILYAMSTW 681
                       ********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.996277662IPR005202Transcription factor GRAS
PfamPF035141.7E-104304681IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 691 aa     Download sequence    Send to blast
MAAAAPQLEE LVDLEPFSPS LFLDLPPTPH SDDPNDDDLI LPFISRMLME DDIDDKFFYQ  60
FPDHPALLHA QQPYAQILDA PSDDTTTNSF DDSASATTNN TTNSAATANA SWPYDPIELS  120
QLLQSPPHPV SDNHDADVGD TRSAPEDDKD LKLLFSAADN MEMLNMAFLK GREEANKLVP  180
TNNTLFAGFD GASLLKTEPA VDEPTLMFGR SGGSGRGRKN RHGEEDDLEA ETGRSSKLMV  240
PPQEDTAAAS EMFDEIMFNG YEVIMKGMEE LRVAMDSEAE KKARNGGGAG RRAARAKAAV  300
VDLHTLLIHC AQAVATSDRR SATELLKQIK QNSSARGDAT QRLACCFAEG LEARLAGTGS  360
QVYKSLVAKC TSTVDFLKAY KLFAAACCIK KVSFIFSNKT ILDAVAGKRK LHIVDYGLSY  420
GFQWPGLFKC LSEREGGPPE VRITGIDFPQ PGFRPADQIE ETGRRLSNCA RQFGVPFRFQ  480
AIAAKWETVR REDLHLDREE EEEEEEVLVV NCLHGLNTLQ DESVVVDSPS PRDVVLNNIR  540
DMRPHVFVQC VVNGAYGAPF FLTRFRETLF FYSSQFDMLD ATIPRDNDER LLIERDILGR  600
CALNVIACEG ADRVDRPETY KQWLVRNHRA GLTQLPLQPQ VVELVRDKVK KLYHKDFVID  660
VDHNWLLQGW KGRILYAMST WVADRDHKSL F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-373076818374GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.878320.0callus| leaf| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329874080.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1370640.0AC137064.4 Oryza sativa Japonica Group cultivar Nipponbare chromosome 11 clone OSJNBb0003C04 map S10003, complete sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015617900.10.0PREDICTED: scarecrow-like protein 9
TrEMBLB8BIL50.0B8BIL5_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA035741-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-127GRAS family protein