PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA035654-PA
Common NameOsI_36907
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family M-type_MADS
Protein Properties Length: 269aa    MW: 29454.9 Da    PI: 6.025
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA035654-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF626.9e-201053245
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
            SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                      + en+s r++t+skRr gilKKA+ELS+LCd+   +++fs+++k
  BGIOSGA035654-PA 10 KLENSSGRHITYSKRRSGILKKAKELSILCDIPLILLMFSPNDK 53
                      679*************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.016153IPR002100Transcription factor, MADS-box
SMARTSM004326.6E-26160IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.37E-24292IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-15323IPR002100Transcription factor, MADS-box
PfamPF003193.8E-171154IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-152338IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-153859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MGRVKLKIKK LENSSGRHIT YSKRRSGILK KAKELSILCD IPLILLMFSP NDKPTICVGD  60
HSSIEDVITK YAQQTPQERA ERKLERLEFQ NDMQLPLGLT GDPNTSSWFH GGGGAEAQQP  120
MMLPEDPSLL HQRDIGCSAS TSLQSYPGYF SMGKQSTDNA GGGEQHHHAA VQQQPEFSQA  180
DCLTSLQLGA QFPYPSAFDN AGLLSDRLFD NAAAAAAAMD FGGHYDLPRP GDEASFQNWA  240
SAACGATMYD HQQQQQQQQQ PAQVSSKLD
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.738060.0flower| panicle
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFM9565050.0FM956505.1 Oryza sativa Japonica Group mRNA for MADS68 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618002.11e-113agamous-like MADS-box protein AGL65 isoform X1
RefseqXP_015618003.11e-113agamous-like MADS-box protein AGL65 isoform X2
RefseqXP_015618004.11e-113agamous-like MADS-box protein AGL65 isoform X3
TrEMBLA2ZGK00.0A2ZGK0_ORYSI; Uncharacterized protein
STRINGOPUNC11G18320.11e-166(Oryza punctata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46263659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69540.15e-36AGAMOUS-like 94