PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA034352-PA
Common NameOsI_35443
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family B3
Protein Properties Length: 422aa    MW: 47922.3 Da    PI: 9.786
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA034352-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B358.21.5e-1848137198
                       EEEE-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
                B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                       ff vl++    ++ r+ +p +f  ++ ++++++  +++l d+sg++W+ +l  +  s+++++  GWkeFv++n ++ g f+vF++d+rs+f  
  BGIOSGA034352-PA  48 FFRVLLT--LQSLERMKIPSSFN-QClQNQPTG--MVSLVDRSGNKWSAEL--TSDSEGFFFVHGWKEFVRDNSIQCGQFLVFTYDKRSQF-- 131
                       5666633..4456679******8.564767666..8***************..*********************************99999.. PP

                       EEEEE- CS
                B3  93 vvkvfr 98 
                        v+vf+
  BGIOSGA034352-PA 132 SVTVFE 137
                       888876 PP

2B352.21.1e-16316407398
                       EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
                B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                       ++++ s+v     + +p +f++e+   ++++k +tl d++g+ Wev++ y   ++   +++GW +F+  n+L+  D++vF+l+++++   +v+
  BGIOSGA034352-PA 316 QIMMESYVYVGFFMNIPCEFVRECL--PRTNKRITLWDPQGKAWEVNYVYYSDRSVGSFSGGWGKFAVGNNLEKFDVCVFELVQKDN--IKVH 404
                       6789999999**************5..345678***************995555556799*********************998444..5788 PP

                       EE- CS
                B3  96 vfr 98 
                       ++r
  BGIOSGA034352-PA 405 IYR 407
                       776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd100171.50E-1746136No hitNo description
PROSITE profilePS5086314.77646139IPR003340B3 DNA binding domain
SuperFamilySSF1019363.01E-2247143IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.106.3E-2147139IPR015300DNA-binding pseudobarrel domain
SMARTSM010198.1E-1548139IPR003340B3 DNA binding domain
PfamPF023621.6E-1655136IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.109.8E-26306407IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.83E-25307407IPR015300DNA-binding pseudobarrel domain
CDDcd100172.40E-23312407No hitNo description
PROSITE profilePS5086313.352314409IPR003340B3 DNA binding domain
SMARTSM010195.0E-15314409IPR003340B3 DNA binding domain
PfamPF023627.7E-15316407IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 422 aa     Download sequence    Send to blast
MDRRKNREVG RSRREEERVV MVVGEEQGGW MEKGKEKEGD INCFGRSFFR VLLTLQSLER  60
MKIPSSFNQC LQNQPTGMVS LVDRSGNKWS AELTSDSEGF FFVHGWKEFV RDNSIQCGQF  120
LVFTYDKRSQ FSVTVFEPSG IDKISTFSAH PSKNVIIKTE SDEGGMVTAA ITTEKMAPAL  180
KENNGITGKR TRDVDYLMED RVVVFKKSSE ANVCESSRRK RAGASAGKSK VTSTSHNSTR  240
GSSCSSDEDN SSSKSPNPPF LMRFLSGEVS RRGRCVSKGQ RQLTVISQRR PVTEAEKDHA  300
LQRAREFKSK NPFAVQIMME SYVYVGFFMN IPCEFVRECL PRTNKRITLW DPQGKAWEVN  360
YVYYSDRSVG SFSGGWGKFA VGNNLEKFDV CVFELVQKDN IKVHIYRVVP EITPHKLRSD  420
PK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A4e-1328740822142B3 domain-containing transcription factor VRN1
4i1k_B4e-1328740822142B3 domain-containing transcription factor VRN1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.525080.0callus| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329775890.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1019410.0AK101941.1 Oryza sativa Japonica Group cDNA clone:J033074I03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615373.10.0B3 domain-containing protein Os11g0197600
SwissprotQ2R9D20.0Y1176_ORYSJ; B3 domain-containing protein Os11g0197600
TrEMBLB8BJK10.0B8BJK1_ORYSI; Uncharacterized protein
STRINGOS11T0197600-010.0(Oryza sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44613766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42700.12e-17B3 family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]