PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA032818-PA
Common NameOsI_33316
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HD-ZIP
Protein Properties Length: 301aa    MW: 33001.3 Da    PI: 4.8582
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA032818-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.17.4e-1951104356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k++++ +eq+++Le+ Fe +++++ e+++++A+ l+L  rqV vWFqNrRa++k
  BGIOSGA032818-PA  51 KKRRLAAEQVRALERSFEADNKLDPERKARIARDLRLHPRQVAVWFQNRRARWK 104
                       4557899**********************************************9 PP

2HD-ZIP_I/II125.42.5e-4050142193
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                       ekkrrl++eqv++LE+sFe+++kL+perK+++ar+L+l+prqvavWFqnrRAR+ktkq+E+d++aL++++dal+ e ++L++++++L+ e++e
  BGIOSGA032818-PA  50 EKKRRLAAEQVRALERSFEADNKLDPERKARIARDLRLHPRQVAVWFQNRRARWKTKQIERDFAALRSRHDALRLECDALRRDKDDLAGEIDE 142
                       69*************************************************************************************998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-1929107IPR009057Homeodomain-like
SuperFamilySSF466892.31E-1843108IPR009057Homeodomain-like
PROSITE profilePS5007116.55246106IPR001356Homeobox domain
SMARTSM003891.6E-1849110IPR001356Homeobox domain
CDDcd000861.95E-1651107No hitNo description
PfamPF000463.7E-1651104IPR001356Homeobox domain
PROSITE patternPS00027081104IPR017970Homeobox, conserved site
PfamPF021832.8E-12106145IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MAIIHDTSDQ QEDNMRSYMD GGGAAAYEEE EEEVEDDDGG GGGGGGGLGE KKRRLAAEQV  60
RALERSFEAD NKLDPERKAR IARDLRLHPR QVAVWFQNRR ARWKTKQIER DFAALRSRHD  120
ALRLECDALR RDKDDLAGEI DELRDRPKRL EQASPMFPRT VACMDATRLV SWVNYLSTMC  180
KQLALYLLKV VDGSTDSDSS AVFNEEASPY SGAAIDHHHH QTPASYDTAG FTSFFAPSTT  240
LTSSLSFPSM FHASSHFDGH QELLVGGGGA GAVADADLGG AGFFAGDEHA GGLSWYGAEG  300
W
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
198106RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.85980.0callus| flower| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1166313190.0
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf blades and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8376740.0CT837674.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA120C09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613231.11e-139homeobox-leucine zipper protein HOX8
SwissprotQ338Z71e-140HOX8_ORYSJ; Homeobox-leucine zipper protein HOX8
TrEMBLB8BGJ10.0B8BGJ1_ORYSI; Uncharacterized protein
STRINGONIVA10G07840.11e-140(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65310.22e-38homeobox protein 5
Publications ? help Back to Top
  1. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]