PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA029420-PA
Common NameOsI_32079
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family TCP
Protein Properties Length: 381aa    MW: 38771.1 Da    PI: 4.76
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA029420-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP103.24.3e-32122210594
               TCP   5 kdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaaksa 94 
                         r+ ++h kv+gR+RR+R++++caar+ +L++eLG+++d++ti WL+qq++pai ++tgt++ +a ++ +++ +    ++s ++aa+ +
  BGIOSGA029420-PA 122 PPRNRDRHVKVEGRGRRIRMPVNCAARIAQLTRELGHKSDGETIRWLMQQSEPAIVAATGTGTVPAIAT-TVDGVLRIPTESPSAAARGD 210
                       5799*********************************************************99999444.44444444433333333332 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036345.2E-26125204IPR005333Transcription factor, TCP
PROSITE profilePS5136925.128125179IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MASQLQGKGA ETAAAGERVA PGTNAAAFAG LGYPPIQSPV ALQEEEGPRD AAFAGYAPIR  60
SPVVSRLQEK GEGEGEEEEV DKREEAGMAA DGSAFAAGMA LVPKPEPVAV EFLRGLAVAK  120
PPPRNRDRHV KVEGRGRRIR MPVNCAARIA QLTRELGHKS DGETIRWLMQ QSEPAIVAAT  180
GTGTVPAIAT TVDGVLRIPT ESPSAAARGD EPAPKRRRKL QPTRAAAGGP VEALAAAPPP  240
AVYYPIVADP LLQANGGGSI SISSGLAPAS SATPPTATGG GAIPFIAMPA TSDGGKQAMS  300
PATVWMVPPG GAGAVNQPIQ YWAFQPNPDH ANFAGASSYN VGQNPGVHEA SAADHAASTG  360
GGGGGEDDEY EGMTDSSSDE E
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1213219PKRRRKL
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings and leaves, mostly in the lower region rich in dividing cells. {ECO:0000269|PubMed:9338963}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681}.
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681, ECO:0000269|PubMed:9338963}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126170.0CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612634.10.0transcription factor PCF2-like
SwissprotA2YXQ12e-83PCF2_ORYSI; Transcription factor PCF2
SwissprotQ6ZBH62e-83PCF2_ORYSJ; Transcription factor PCF2
TrEMBLA2Z3800.0A2Z380_ORYSI; Uncharacterized protein
TrEMBLQ650T30.0Q650T3_ORYSJ; Os09g0521300 protein
STRINGOS09T0521300-000.0(Oryza sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39123167
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45680.11e-41TCP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]