PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA023996-PA
Common NameOsI_26666
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HRT-like
Protein Properties Length: 622aa    MW: 68791.6 Da    PI: 9.5845
Description HRT-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA023996-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HRT-like57.22.7e-18311340130
          HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmR 30 
                       +CGv+ledGs C ++Pv+gRKRCe HKG+R
  BGIOSGA023996-PA 311 VCGVMLEDGSSCLDHPVQGRKRCELHKGRR 340
                       7****************************9 PP

2HRT-like52.77.1e-17585614130
          HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmR 30 
                       iCG++ +dGs+Ck+qP+ gRKRC+ HKG+R
  BGIOSGA023996-PA 585 ICGARASDGSPCKNQPIAGRKRCAMHKGQR 614
                       8****************************9 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000033Biological Processregulation of seed dormancy process
GO:0097100Molecular Functionsupercoiled DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 622 aa     Download sequence    Send to blast
MPAASTAVPA RLKREDYPRT KHDSLFSPWK VLVGPSDWED HAAGKEGIQR YRVLNLPENF  60
PGLYELGVAR ASDEGIRAAR RWNGSGGGGV VVVYLGQADS VRARLQQYGR TGSHLDAGNP  120
PPSAGEAETN TRATGNGLFR EVFVRGYSLV FRCALMGNKQ EAEKTEARLL RVFDYAWNKL  180
QNGGLRREEI LIKLEQGAVN NRSSLLSRVR HFKQEVFREK AGIKISRNGS VDVSSGIMKN  240
MLPRIRTFVG FRPQLVNSGD NVDKEIGIRW KNTSEGNSYG KQARRSSEGY KVKRVNVIKR  300
RTMPEQDSND VCGVMLEDGS SCLDHPVQGR KRCELHKGRR LGRITVNPKG SSCSYSCQVE  360
IPVVESISPL TENESESDQA QQTSELLSKF LPETVKKSSR PWYSFEAKEI KTGEAPIEDG  420
KQETSEVIDI CEAKKSDNSA CTNKVISGSK KCQLHNGCKA EEFVSSRVID LLQNEEKVKS  480
MTVDKFSGEE ISHGKYQSQE NQPSGRMWFE LIKLQNPTST LSSKGQGRQK RVTGNVAAIC  540
EALTDNRCRE TIPMAGRERC DAHEGIKVTD ASSVPFSGSS GWPSICGARA SDGSPCKNQP  600
IAGRKRCAMH KGQRACRTPS ID
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.380560.0callus| flower| leaf| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329880010.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1027920.0AK102792.1 Oryza sativa Japonica Group cDNA clone:J033107P15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644815.10.0PREDICTED: uncharacterized protein LOC4343751
TrEMBLA0A0E0I2Z30.0A0A0E0I2Z3_ORYNI; Uncharacterized protein
TrEMBLA2YN540.0A2YN54_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA023996-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79483443
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56780.11e-70effector of transcription2