PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA018041-PA
Common NameOsI_19993
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 414aa    MW: 44333.3 Da    PI: 6.9628
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA018041-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1583.9e-49391642128
               NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                       +pGfrFhPt+eel+ +yL++kveg+++++ e i+ +d+y+++Pw+Lp+++  +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ +  
  BGIOSGA018041-PA  39 MPGFRFHPTEEELIEFYLRRKVEGRRFNV-ELITFLDLYRFDPWELPAMAVIGEKEWFFYVPRDRKYRNGDRPNRVTASGYWKATGADRMIRG 130
                       79***************************.89***************7777899*************************************** PP

               NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       ++++ +glkktLvfy+g+apkg++++W+m+eyrl
  BGIOSGA018041-PA 131 ENSRPIGLKKTLVFYSGKAPKGVRSSWIMNEYRL 164
                       ********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-5738187IPR003441NAC domain
PROSITE profilePS5100554.84938187IPR003441NAC domain
PfamPF023651.7E-2440164IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MSRDDVTAGA AGSGEEAAAD QEEAAAAVAG DSHENDLVMP GFRFHPTEEE LIEFYLRRKV  60
EGRRFNVELI TFLDLYRFDP WELPAMAVIG EKEWFFYVPR DRKYRNGDRP NRVTASGYWK  120
ATGADRMIRG ENSRPIGLKK TLVFYSGKAP KGVRSSWIMN EYRLPPPAAD ADLFYKSEIS  180
LCRVYKRSGI DDGHGHHQRP AGNVQASSSS AAARPPEQHS GNNTAAGLPA CRHRPSPSSS  240
STTTAQQHTS FHQLLQGECS AAAAAAPPPP SLPASATTRN SNASQLLMPP PPPRPPCAAA  300
YTSAAAAPTE SAAVLAAAST YSLLAAAGSS STHIDELSTL LAGHSHGGAY GNNHIVAGSH  360
HHFPLPPSQL MPQLGTLPIS PPLAAVSDRL WDWSSVPDTS TARDYDSSGF SDPK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-564018819166NO APICAL MERISTEM PROTEIN
1ut4_B8e-564018819166NO APICAL MERISTEM PROTEIN
1ut7_A8e-564018819166NO APICAL MERISTEM PROTEIN
1ut7_B8e-564018819166NO APICAL MERISTEM PROTEIN
4dul_A8e-564018819166NAC domain-containing protein 19
4dul_B8e-564018819166NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.272160.0leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154639360.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126130.0CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637953.10.0PREDICTED: NAC domain-containing protein 48-like
TrEMBLA2Y4R50.0A2Y4R5_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA018041-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28263787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.11e-95NAC domain containing protein 35