PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA015021-PA
Common NameOsI_16036
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MIKC_MADS
Protein Properties Length: 262aa    MW: 29466.2 Da    PI: 9.3218
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA015021-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF78.83.9e-2568116250
                       ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
            SRF-TF   2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 
                       rien   rqvtf+kRr g+lKKA+ELSvLCda++ vi+fs++gk+ye +
  BGIOSGA015021-PA  68 RIENPVHRQVTFCKRRMGLLKKAKELSVLCDADIGVIVFSPHGKIYELA 116
                       8*********************************************965 PP

2K-box59.21.7e-20138232598
             K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGe.dLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                       + +s+e++  +  qq++  L++e++ Lq+++R + Ge d++ ++l eLq+Le++Le  +++iRs+K++++ ++ie l++ke  l+ +n  L++
  BGIOSGA015021-PA 138 QAESNEQNIPQVIQQDVLLLRQEVDLLQNSLRYMYGErDISHMNLGELQSLESNLEVWVNNIRSTKMQIMSREIEMLKNKEGILKAANDILQE 230
                       4555677778999***********************978****************************************************99 PP

             K-box  97 kl 98 
                       ++
  BGIOSGA015021-PA 231 RI 232
                       87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.3E-3559118IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.2459119IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.14E-2859135IPR002100Transcription factor, MADS-box
CDDcd002655.96E-3860133No hitNo description
PRINTSPR004046.3E-266181IPR002100Transcription factor, MADS-box
PROSITE patternPS00350061115IPR002100Transcription factor, MADS-box
PfamPF003197.4E-2468114IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-268196IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-2696117IPR002100Transcription factor, MADS-box
PfamPF014862.0E-23141232IPR002487Transcription factor, K-box
PROSITE profilePS5129713.227147239IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MAGLPKLFPV PPKATIKTPP LLRQIQAVIS LKSSGRSKGL AATATASEAS SNYDSVGDMA  60
RGKVQMRRIE NPVHRQVTFC KRRMGLLKKA KELSVLCDAD IGVIVFSPHG KIYELATNGN  120
MQGLIERYKN KSNLPEAQAE SNEQNIPQVI QQDVLLLRQE VDLLQNSLRY MYGERDISHM  180
NLGELQSLES NLEVWVNNIR STKMQIMSRE IEMLKNKEGI LKAANDILQE RIIAQTSIMD  240
VGCNMMIPQV PFQLTTESNY YF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A5e-1559142183MEF2 CHIMERA
6byy_B5e-1559142183MEF2 CHIMERA
6byy_C5e-1559142183MEF2 CHIMERA
6byy_D5e-1559142183MEF2 CHIMERA
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in leaves and spikelets (rice flower). {ECO:0000269|Ref.7}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
UniProtProbable transcription factor.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020194477.11e-120MADS-box transcription factor 26-like
RefseqXP_020194478.11e-120MADS-box transcription factor 26-like
SwissprotA2YQK95e-77MAD26_ORYSI; MADS-box transcription factor 26
SwissprotQ0J8G85e-77MAD26_ORYSJ; MADS-box transcription factor 26
TrEMBLA2XTV60.0A2XTV6_ORYSI; Uncharacterized protein
STRINGONIVA04G12010.11e-149(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.11e-57AGAMOUS-like 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Lee S, et al.
    Further characterization of a rice AGL12 group MADS-box gene, OsMADS26.
    Plant Physiol., 2008. 147(1): p. 156-68
    [PMID:18354041]
  3. Khong GN, et al.
    OsMADS26 Negatively Regulates Resistance to Pathogens and Drought Tolerance in Rice.
    Plant Physiol., 2015. 169(4): p. 2935-49
    [PMID:26424158]