PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA012017-PA
Common NameHOX13, OsI_10318
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HD-ZIP
Protein Properties Length: 312aa    MW: 33684.8 Da    PI: 4.3765
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA012017-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.45.9e-1973125456
                       -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       ++++  eq+++Le+ F  +++++ ++++++A+ lgL+ rqV vWFqNrRa++k
  BGIOSGA012017-PA  73 KRRLALEQVRALERSFDTDNKLDPDRKARIARDLGLQPRQVAVWFQNRRARWK 125
                       4467789*********************************************9 PP

2HD-ZIP_I/II121.54.3e-3971164193
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkray.dalkeenerLekeveeLreelk 92 
                       ekkrrl+ eqv++LE+sF++++kL+p+rK+++ar+LglqprqvavWFqnrRAR+ktkqlE+d++aL++++ dal+++ ++L++++++L++e++
  BGIOSGA012017-PA  71 EKKRRLALEQVRALERSFDTDNKLDPDRKARIARDLGLQPRQVAVWFQNRRARWKTKQLERDFAALRAQHnDALRADCDALRRDKDALAAEIR 163
                       69*****************************************************************98747899**************9998 PP

       HD-ZIP_I/II  93 e 93 
                       e
  BGIOSGA012017-PA 164 E 164
                       6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.24E-1861129IPR009057Homeodomain-like
SMARTSM003894.1E-1970131IPR001356Homeobox domain
PROSITE profilePS5007116.43971127IPR001356Homeobox domain
CDDcd000861.42E-1772128No hitNo description
PfamPF000463.4E-1673125IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.7E-2079126IPR009057Homeodomain-like
PRINTSPR000312.8E-598107IPR000047Helix-turn-helix motif
PROSITE patternPS000270102125IPR017970Homeobox, conserved site
PRINTSPR000312.8E-5107123IPR000047Helix-turn-helix motif
PfamPF021836.1E-14127169IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MKRPTSSSRK SKKQGEDLAF SEEGSLPAVT MEQKDEAEME EVDDEEEEEV DEDMAGGHAA  60
QSPSPSCGLG EKKRRLALEQ VRALERSFDT DNKLDPDRKA RIARDLGLQP RQVAVWFQNR  120
RARWKTKQLE RDFAALRAQH NDALRADCDA LRRDKDALAA EIRELREKLP TKPADTAASV  180
KVEAGNDAAA GAAAATVCKD GSSDDSDSSV VFNDEASPYS GAAFIGFGPS FLVDDASAAT  240
VGCSSSLPAL ESKWHGPYSD DSCKGGVYGF TEEWLAACSG EMAGNDAAGF FSDEHASNLN  300
FGWCASGNEG WE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1119127RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.380130.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329867310.0
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8310390.0CT831039.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCEA023E12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628283.10.0homeobox-leucine zipper protein HOX13 isoform X1
SwissprotA2XDD60.0HOX13_ORYSI; Homeobox-leucine zipper protein HOX13
TrEMBLA0A0D9Z3760.0A0A0D9Z376_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0G2940.0A0A0E0G294_ORYNI; Uncharacterized protein
TrEMBLA0A0E0NQT30.0A0A0E0NQT3_ORYRU; Uncharacterized protein
STRINGOGLUM03G06560.10.0(Oryza glumipatula)
STRINGORUFI03G06390.10.0(Oryza rufipogon)
STRINGOS03T0188900-010.0(Oryza sativa)
STRINGONIVA02G06360.10.0(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22430.15e-32homeobox protein 6
Publications ? help Back to Top
  1. Agalou A, et al.
    A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members.
    Plant Mol. Biol., 2008. 66(1-2): p. 87-103
    [PMID:17999151]