PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA009949-PA
Common NameOsI_13223
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GeBP
Protein Properties Length: 339aa    MW: 36537.9 Da    PI: 7.6946
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA009949-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57387.31.9e-2751145297
            DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskk 94 
                       +fqr+wse+De+ +LqGl+ +   +g     d++ fy+ +++s+ + +++sql+eK+rrLK+Kf+++++++++g +p+  ++hd+++++l+++
  BGIOSGA009949-PA  51 KFQRIWSESDELRFLQGLLGC-GAQGLVFPRDLNVFYDRFSESMPSPYTRSQLSEKLRRLKNKFRGMSARVARGLDPARLAPHDRDVLHLCSR 142
                       79*******************.556878888************************************************************** PP

            DUF573  95 iWg 97 
                       +W+
  BGIOSGA009949-PA 143 LWD 145
                       **8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.1E-2452145IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MASDQTLPVP VSLPVKRRSP PPRPSSPSSS DPASSDPAAK QQPQQPPPPF KFQRIWSESD  60
ELRFLQGLLG CGAQGLVFPR DLNVFYDRFS ESMPSPYTRS QLSEKLRRLK NKFRGMSARV  120
ARGLDPARLA PHDRDVLHLC SRLWDPANAA TSPFAAAGDA SSGNKRRRAA PRAGPLMPPD  180
PSGDSNSHDY NGGISAGTPG AFGDGHGGEE MMYLEQESGH FGYHGDVAIA ADGSLDGIVK  240
VQPETLPALP SIGDIAVHSE NGNGKAVVPR SNEHHMANAV LDIFEECLRE VKANGITYGA  300
NVNGGSELAR RWRAQRIDEL DVLSRRLRLL VEDAAAAGR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.505270.0callus| flower| leaf| panicle| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0871810.0AC087181.9 Oryza sativa Japonica Group cultivar Nipponbare chromosome 3 clone OSJNBa0018H01 map R1538, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankCT8338990.0CT833899.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN056B15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628567.10.0probable transcription factor At5g28040
TrEMBLB8AQC00.0B8AQC0_ORYSI; Uncharacterized protein
STRINGORUFI03G32760.10.0(Oryza rufipogon)
STRINGOS03T0708800-010.0(Oryza sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP86953243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04930.22e-09DNA-binding storekeeper protein-related transcriptional regulator