PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA006113-PA
Common NameOsI_07927
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family B3
Protein Properties Length: 972aa    MW: 109504 Da    PI: 9.285
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA006113-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B331.82.5e-109099663595
                       EEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
                B3  35 tltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                        ++l+d+  r W v +    k+  + +t+GWk F+ an+L++gD++ F  +  +e el ++
  BGIOSGA006113-PA 909 VVILKDPMRRLWPVFY--HDKPVFVGFTAGWKPFAAANNLQAGDVCKFVKEM-DEDELAFQ 966
                       689*************..9***9*************************9443.44444444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086310.489277370IPR003340B3 DNA binding domain
SuperFamilySSF1019361.75E-16279372IPR015300DNA-binding pseudobarrel domain
SMARTSM010196.0E-4280370IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.4E-14280370IPR015300DNA-binding pseudobarrel domain
PfamPF023622.9E-7289366IPR003340B3 DNA binding domain
CDDcd100172.59E-7292367No hitNo description
SMARTSM010190.03882971IPR003340B3 DNA binding domain
SuperFamilySSF1019362.55E-12900971IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.1E-11903971IPR015300DNA-binding pseudobarrel domain
CDDcd100171.47E-13907971No hitNo description
PfamPF023621.7E-7908968IPR003340B3 DNA binding domain
PROSITE profilePS5086310.278910972IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 972 aa     Download sequence    Send to blast
MRDGDDEEKK KCSRQDMKKN LRNDADEEKR KSSDDMRDGD DEEKKKRSRH DMKKNSRNDA  60
DEEKRKRKRK CSDDLKKSVV NDASKEATSH SDWRKNRKAG SDSEQRGKKL LNGDKKAKSR  120
KVTTPFFEKM RKIKMQRTSN QNGEKNMKSD GDSYKKTVPL SVNKGKMEKD GTNKRTLSNT  180
LVAKERKMRP SDSMEMKMKK KKRDASFVQP DERTAQTFST KNKEKKRKAP STPLKREQKE  240
RVASSDNKKE TKKACIVAIG NEKKNCRDGK KKKRKAAFAF FKFVRDEFEE LLFIPPAVAP  300
SLKDLIDRHV YLEDSEGKCS KIRLSVVDGS LAFYEGWNSF VSEHCIKWGE FLLFEYTPES  360
TFSVRVFGID SCERLHFSVK SGGKGAVKKR KERHTLSDDL ISHYNGQYQD SEDIHDGPNV  420
SGESPRSKEP KITVDAEIGT RNLVAKSINA ASEIQDSERV ESGIGYGSLG ALGNKVRNLS  480
NGECDTRSDS VFCIQEKTRR SEVIIISDEA YSTQVDEDTM KQTAPSEASE IHHVTINTQK  540
DLERVVDGVC CESSVALNNK MGNLILGEPQ NKNISPACST EKTNGSEITP TTGAIPLTQE  600
NIDTVKLNTL SCFEEDRSTT RESELAAAIP TTSETHDSDK DLGQKHQRNS VQVNSIIAVD  660
KYPNDSEMNI SGNIFRIYEA PAGTRCLEKW KRGIVNGRAA LDDIGQVRPE KTQKAGEKLV  720
GNCGAMGESP VDLRIESDVT DTCLKPILNI PIEELSILDS VSISKCGRSR TEVNHLFNQK  780
GATVQLQTKK EPLKPTGSSG NRKGDKIAVS VNRVFAHQSE LQIPQQENGN FTSCVTPVAL  840
LPAKAELLDL DDHSLQFCIP STIQKWLVFS YSVVQWMQFV EFMLIAVRAE LPKSLPITCR  900
QKGRYDRNVV ILKDPMRRLW PVFYHDKPVF VGFTAGWKPF AAANNLQAGD VCKFVKEMDE  960
DELAFQVYIT RK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14466KKRSRHDMKKNSRNDADEEKRKR
26369KRKRKRK
36469RKRKRK
4269274KKKKRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.505930.0callus
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379916130.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1219900.0AK121990.1 Oryza sativa Japonica Group cDNA clone:J033109I02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624189.10.0PREDICTED: B3 domain-containing protein Os02g0598200
RefseqXP_015624190.10.0PREDICTED: B3 domain-containing protein Os02g0598200
SwissprotQ6K5K20.0Y2982_ORYSJ; B3 domain-containing protein Os02g0598200
TrEMBLB8AF310.0B8AF31_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA006113-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122722730
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18960.12e-11B3 family protein