PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA005839-PA
Common NameOsI_08482
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRAS
Protein Properties Length: 618aa    MW: 64196.4 Da    PI: 9.1169
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA005839-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS302.97.5e-932546182374
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       ++lL e+A av++g++++a +lL+ l+  a+p+gd+ qRl+a+++ AL++r+           p+++ ++  s e+ aa +l+++vsP++ ++
  BGIOSGA005839-PA 254 RQLLSEAAAAVADGNHTAAASLLSALKLSANPRGDAEQRLVAMMVAALSSRVGT--------GPSQHLADLYSGEHRAACQLLQDVSPCFGLA 338
                       689*************************************************98........5666666666899999*************** PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skeeleetgerLakfAeelgvpfefnvlva 183
                          aN aIl+av+g++++H +Dfd+s  +Q +aL++aLa+R+ ++ sl++T+v++p+s      +++l +t erL+k+A++ g++f+f++ v+
  BGIOSGA005839-PA 339 LHGANLAILDAVAGHRAIHFVDFDVSA-AQHVALIKALADRRVPATSLKVTVVADPTSPftpaMTQSLAATCERLKKLAQQAGIDFRFRA-VS 429
                       *************************85.8**************************9988899999*************************.78 PP

              GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklp 276
                        r  ++e ++L ++pgEalaVnl++ l r++desvs +++rde+L+ v+ l P+vv++veqe+++n+++ ++rf++a  +y a+++sl+a+l+
  BGIOSGA005839-PA 430 CRAPEIEASKLGCEPGEALAVNLAFTLSRVPDESVSPANPRDELLRRVRALGPRVVTLVEQELNTNTAPMAARFSDASAHYGAVLESLDATLG 522
                       99******************************************************************************************* PP

              GRAS 277 reseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvs 369
                       r+s +r+  E++ l+ ++ n+v  eg +r+er+e ++kWr+r+++aGF++v+++e++   +++ l       + v+ ++g l  gW++r +++
  BGIOSGA005839-PA 523 RDSADRTRAEAA-LASKVANAVGREGPDRVERCEVFGKWRARFGMAGFRAVAIGEDIGGRVRARLGPAL-PAFDVKLDNGRLGVGWMGRVVTV 613
                       ***********9.9***************************************************9998.66********************* PP

              GRAS 370 vSaWr 374
                       +SaWr
  BGIOSGA005839-PA 614 ASAWR 618
                       ****8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.082227599IPR005202Transcription factor GRAS
PfamPF035142.6E-90254618IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 618 aa     Download sequence    Send to blast
MDPAGAPWCD PRRGYGGYGV GSAALQAAAR QQSQQPRSDG AGGAGVTGGV LKRSLGEMER  60
WQQQRQVAAQ QAMYLRSVRQ RMDIGAVLGG AASSPAYGIS GLSSGFGGIS QQQPSSTMSS  120
LTTASRTVMS GMQQQRRMMA VPTAQNQAVA RAPAARPATA TELVLLQELE KQLLGDDEEA  180
DAAGSGCGSG ITSSDWGDTI QRLNSVTAAS SPSLPLPTAV NSTALLARSP TNSSSSTASS  240
SASSSPPISA ASSRQLLSEA AAAVADGNHT AAASLLSALK LSANPRGDAE QRLVAMMVAA  300
LSSRVGTGPS QHLADLYSGE HRAACQLLQD VSPCFGLALH GANLAILDAV AGHRAIHFVD  360
FDVSAAQHVA LIKALADRRV PATSLKVTVV ADPTSPFTPA MTQSLAATCE RLKKLAQQAG  420
IDFRFRAVSC RAPEIEASKL GCEPGEALAV NLAFTLSRVP DESVSPANPR DELLRRVRAL  480
GPRVVTLVEQ ELNTNTAPMA ARFSDASAHY GAVLESLDAT LGRDSADRTR AEAALASKVA  540
NAVGREGPDR VERCEVFGKW RARFGMAGFR AVAIGEDIGG RVRARLGPAL PAFDVKLDNG  600
RLGVGWMGRV VTVASAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-372496181375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.497020.0callus| flower| leaf| panicle| root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379903980.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126100.0CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623156.10.0PREDICTED: scarecrow-like protein 8
TrEMBLA0A0E0GBE80.0A0A0E0GBE8_ORYNI; Uncharacterized protein
TrEMBLA2X8C40.0A2X8C4_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA005839-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.15e-94SCARECROW-like 8