PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA005764-PA
Common NameOsI_08632
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Dof
Protein Properties Length: 323aa    MW: 33519.1 Da    PI: 9.2868
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA005764-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.81.4e-3969128261
            zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                       +++ lkcprC+st+tkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk++
  BGIOSGA005764-PA  69 HDQPLKCPRCESTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGSLRNVPVGGGCRKNKRA 128
                       7899*****************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-3168127IPR003851Zinc finger, Dof-type
PfamPF027013.4E-3370127IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.22773127IPR003851Zinc finger, Dof-type
PROSITE patternPS01361075111IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010067Biological Processprocambium histogenesis
GO:0010087Biological Processphloem or xylem histogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MAKLASCMTA SIYSTAINPR NKLNRNNKGI VPEEHGMGSS SPSAELIACP RAPMQAAAAA  60
ADRRLRPQHD QPLKCPRCES THTKFCYYNN YSLSQPRYFC KTCRRYWTKG GSLRNVPVGG  120
GCRKNKRAPP KKAAAHAQPA VAVAAALQGR HMETGLHLSF SGMQRHLAPP PPPAATAADP  180
LCSLGLFDWK QYDPVFAGSG GGGSPVAALE SAGGSEAQFM GAGMMGIGGG GGGGVAEYHA  240
LSALRYAAGL GDHLALPFGA GRAEHDAVEV KPVAAERLLS LEWCGEASRT AAPESSISSL  300
GGLGLWSGMI GGGHHHHGSS AAI
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO333324100.0
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00580DAPTransfer from AT5G62940Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126100.0CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623280.11e-159dof zinc finger protein DOF3.1
TrEMBLA2X8S00.0A2X8S0_ORYSI; Uncharacterized protein
STRINGONIVA02G32350.10.0(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47043263
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.14e-34Dof family protein