PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA005497-PA
Common NameGRF1, OsI_09149
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRF
Protein Properties Length: 396aa    MW: 43446.3 Da    PI: 7.6116
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA005497-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.99.6e-2590133144
               WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                       d+epgrCrRtDGKkWRCs+++++++k+CE+H+hrg++rsrk++e
  BGIOSGA005497-PA  90 DPEPGRCRRTDGKKWRCSKEAYPDSKYCEKHMHRGKNRSRKPVE 133
                       79***************************************998 PP

2QLQ59.69e-211853237
               QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                      +FTa+Q+q+L++Q+l+yKy+a++ P+P++L++++++
  BGIOSGA005497-PA 18 PFTASQWQELEHQALIYKYMASGTPIPSDLILPLRR 53
                      9********************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009519.4E-111753IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.4E-151851IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.8011853IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.57390134IPR014977WRC domain
PfamPF088792.1E-2091133IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0030912Biological Processresponse to deep water
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MMMMSGRPSG GAGGGRYPFT ASQWQELEHQ ALIYKYMASG TPIPSDLILP LRRSFLLDSA  60
LATSPSLAFP PQPSLGWGCF GMGFGRKAED PEPGRCRRTD GKKWRCSKEA YPDSKYCEKH  120
MHRGKNRSRK PVEMSLATPP PPSSSATSAA SNSSAGVAPT TTTTSSPAPS YSRPAPHDAA  180
PYQALYGGPY AAATARTPAA AAYHAQVSPF HLHIDTTHPH PPPSYYSMDH KEYAYGHATK  240
EVHGEHAFFS DGTEREHHHA AAGHGQWQFK QLGMEPKQST TPLFPGAGYG HTAASPYAID  300
LSKEDDDEKE RRQQQQQQQQ HCFLLGADLR LEKPAGHDHA AAAQKPLRHF FDEWPHEKNS  360
KGSWMGLEGE TQLSMSIPMA ANDLPITTTS RYHNDE
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.23470.0callus| panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO65731480.0
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Highly expressed in the intercalary meristem of the internode and in the shoot apex. Detected in the leaf primordia and emerging leaves in the uppermost node. Preferentially localized in the epidermis and in the tissues surrounding vascular bundles of the intercalary meristem of the internode and in adventitious roots of the second highest node. Low expression in the coleoptile and in the youngest leaf. {ECO:0000269|PubMed:10712532, ECO:0000269|PubMed:15295073}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000269|PubMed:15295073}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By gibberellic acid (GA3) and submergence. {ECO:0000269|PubMed:10712532, ECO:0000269|PubMed:15295073}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2018950.0AF201895.1 Oryza sativa growth-regulating factor 1 (GRF1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624121.10.0growth-regulating factor 1
SwissprotA2XA730.0GRF1_ORYSI; Growth-regulating factor 1
TrEMBLA0A0D9YZ520.0A0A0D9YZ52_9ORYZ; Uncharacterized protein
STRINGOGLUM02G35690.10.0(Oryza glumipatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57413652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.12e-51growth-regulating factor 5
Publications ? help Back to Top
  1. van der Knaap E,Kim JH,Kende H
    A novel gibberellin-induced gene from rice and its potential regulatory role in stem growth.
    Plant Physiol., 2000. 122(3): p. 695-704
    [PMID:10712532]
  2. Choi D,Kim JH,Kende H
    Whole genome analysis of the OsGRF gene family encoding plant-specific putative transcription activators in rice (Oryza sativa L.).
    Plant Cell Physiol., 2004. 45(7): p. 897-904
    [PMID:15295073]