PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA004695-PA
Common NameOsI_04217
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WOX
Protein Properties Length: 267aa    MW: 30238.7 Da    PI: 6.3521
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA004695-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.61.6e-2190150257
                       T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
          Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                       r+R+t+t+ ql++Le+ F + n +ps++++++++++l    +++e++V++WFqNrRa+ k+
  BGIOSGA004695-PA  90 RQRWTPTPMQLQILENIFDQgNGTPSKQKIKDITAELsqhgQISETNVYNWFQNRRARSKR 150
                       89*****************99**************************************97 PP

2Wus_type_Homeobox104.38.2e-3489152265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ar+RWtPtp Q++iLe+++++G  tP+k++i++itaeL+++G+i+++NV++WFQNr+aR+++kq
   BGIOSGA004695-PA  89 ARQRWTPTPMQLQILENIFDQGNGTPSKQKIKDITAELSQHGQISETNVYNWFQNRRARSKRKQ 152
                        789***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-1785155IPR009057Homeodomain-like
PROSITE profilePS5007114.83586151IPR001356Homeobox domain
SMARTSM003891.9E-1488155IPR001356Homeobox domain
SuperFamilySSF466892.01E-1889153IPR009057Homeodomain-like
CDDcd000861.45E-1390152No hitNo description
PfamPF000462.6E-1990150IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MEWDKAKASS GEAVDDRGGG EGGLGYVKVM TDEQMEVLRK QISIYATICE QLVEMHRALT  60
AQQDSIAGMR LGNLYCDPLM VPGGHKITAR QRWTPTPMQL QILENIFDQG NGTPSKQKIK  120
DITAELSQHG QISETNVYNW FQNRRARSKR KQAALPNNNA ESEAEADEES PTDKKPKSDR  180
PLHQNIAMRD HNSERISEMH HFDTEHEQIR RMMYASNDSS SRSSGSLGQM SFYDNVMSNP  240
RIDHFLGKVE SPGSFPHMRS GESFDMY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1143151RRARSKRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.248930.0callus| flower| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1166390180.0
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00669PBMTransfer from GRMZM2G038252Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8293770.0CT829377.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCFA244H01, full insert sequence.
GenBankCT8293760.0CT829376.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCFA218C10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626455.10.0PREDICTED: WUSCHEL-related homeobox 8
SwissprotQ5QMM30.0WOX8_ORYSJ; WUSCHEL-related homeobox 8
TrEMBLA0A0E0FUZ40.0A0A0E0FUZ4_ORYNI; Uncharacterized protein
TrEMBLB8ABA90.0B8ABA9_ORYSI; Putative uncharacterized protein
STRINGLOC_Os01g60270.10.0(Oryza sativa Japonica Group)
STRINGBGIOSGA004695-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38983776
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.12e-71WUSCHEL related homeobox 13