PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA002879-PA
Common NameOsI_00620
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 433aa    MW: 45797.8 Da    PI: 6.0026
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA002879-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.61.1e-31192247156
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                       k+r++W+peLH+rFv+a++ LGG+++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  BGIOSGA002879-PA 192 KARRCWSPELHRRFVNALQILGGAQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 247
                       68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.554189249IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.5E-28190250IPR009057Homeodomain-like
SuperFamilySSF466892.66E-17190250IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-26192247IPR006447Myb domain, plants
PfamPF002498.9E-7194245IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0016036Biological Processcellular response to phosphate starvation
GO:0032107Biological Processregulation of response to nutrient levels
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0080022Biological Processprimary root development
GO:1901699Biological Processcellular response to nitrogen compound
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    Send to blast
MASSSSDLTL DDHHHLTAVA AASGQATQKL QEFLSRLEEE RLKIDAFKRE LPLCMQLLNH  60
AMEAYRQQLE AYQMGSQHGA AAAAAARAPL VLEEFIPVKN IGIDVVAADK AAAAAAGGNS  120
VSSEKASWML ALAPAEKAAD AITIAAGEVD KKPYAHDNGV VARSREAQNG GKPPSTPPDG  180
QAVPPPPQPH RKARRCWSPE LHRRFVNALQ ILGGAQVATP KQIRELMKVD GLTNDEVKSH  240
LQKYRLHTRR PMPSPAPPTA ATPQLVVLGG IWVPPEYATQ AAGPAIYGAH PATQPHYTAA  300
VAAQEYYHHH HHHLQHHPAA AALVHHRAVA PPPPLPPQQQ LAPPYSAKSS ASARLGSPDS  360
DGRGSGGGGG AAASGAGRDM SESIEEEGEG EEREDDDDDD EMAATNNAHA VDGDDDDDEI  420
NTTTTTSAGA INY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-13192245255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-13192245255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-13192245154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-13192245154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-13192245154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-13192245154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-13192245255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-13192245255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-13192245255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-13192245255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-13192245255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-13192245255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.298190.0leaf| panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329950170.0
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may play a role in regulatory networks controlling development and metabolism. {ECO:0000250|UniProtKB:Q6Z869}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00140DAPTransfer from AT1G13300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1098080.0AK109808.1 Oryza sativa Japonica Group cDNA clone:002-147-G07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631343.11e-150transcription factor NIGTH1-like isoform X1
RefseqXP_015631351.11e-150transcription factor NIGTH1-like isoform X2
SwissprotQ5VRW21e-151NOH1_ORYSJ; Transcription factor NIGTH1
TrEMBLA2WLA80.0A2WLA8_ORYSI; Uncharacterized protein
STRINGOS01T0176700-010.0(Oryza sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97733338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13300.12e-41G2-like family protein
Publications ? help Back to Top
  1. Kamrul Huda KM, et al.
    Salinity and drought tolerant OsACA6 enhances cold tolerance in transgenic tobacco by interacting with stress-inducible proteins.
    Plant Physiol. Biochem., 2014. 82: p. 229-38
    [PMID:24992889]