PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA000430-PA
Common NameOsI_04566
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 279aa    MW: 29937.1 Da    PI: 9.3275
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA000430-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.31e-15184234353
                       XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                       + +r++r++kNRe+A rsR+RK+a+i+eLe  v +Le+eN ++ ke ee  
  BGIOSGA000430-PA 184 AMQRQKRMIKNRESAARSRERKQAYIAELESLVTQLEEENAKMFKEQEEQH 234
                       689*************************************99988876644 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.4E-7182244IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.438184232IPR004827Basic-leucine zipper domain
PfamPF001702.2E-14184233IPR004827Basic-leucine zipper domain
CDDcd147073.70E-20186236No hitNo description
SuperFamilySSF579591.44E-10186235No hitNo description
Gene3DG3DSA:1.20.5.1702.8E-13187232No hitNo description
PROSITE patternPS000360189204IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MMASRVMASS SPSHTASDIA RFAAVRGGGG SAGLGSMNVE EILRGIYADM PTPALPLVGG  60
DRPMSPLPAP DVAAAPRTAE EVWKEITGAG VAAAAGGVVP PAAAAAAAPA VVAGAGAGTG  120
AEMTLEDFLA REGAVKEDEA VVTDPSAAKG QVVMGFLNGA EVTGDVTGGR SRKRHLMDPM  180
DRAAMQRQKR MIKNRESAAR SRERKQAYIA ELESLVTQLE EENAKMFKEQ EEQHQKRLKE  240
PSYRNMQYRT QYWLKEMVVP VIIRKTSARD LRRTNSMEW
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.882350.0callus| flower| leaf| panicle| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329779370.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0679190.0AK067919.1 Oryza sativa Japonica Group cDNA clone:J013123H12, full insert sequence.
GenBankGQ9042380.0GQ904238.1 Oryza sativa Japonica Group ABA responsive element binding factor 1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612904.11e-141bZIP transcription factor 12-like
TrEMBLB8A6X90.0B8A6X9_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA000430-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26653786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44080.14e-28bZIP family protein