PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI12G20260.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family CPP
Protein Properties Length: 728aa    MW: 78373.6 Da    PI: 6.4487
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI12G20260.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR49.77.5e-16455494241
              TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                      ++k+C+CkkskClk+YCeCf+ag++Cse C+C++C N  +
  ORUFI12G20260.1 455 SCKRCSCKKSKCLKLYCECFHAGVFCSEPCSCQGCLNMPS 494
                      689**********************************865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011146.5E-16454495IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163417.237455547IPR005172CRC domain
PfamPF036384.2E-12457492IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 728 aa     Download sequence    Send to blast
MDTPDRPPRA AATAAVEDSP VFNFINSLSP IPPPKPSDSA HNVQLFKSSD LAPVSSIFAS  60
PHVNPAKESK LPIREDSVQL SRESHSPNSV RTRTGATSSI IRMIRCKNIV SENCSITCYL  120
NDSTSSKASQ PIQLCGGSAE SDTNQNTDGK KDPTTEQDRT DIEFVLLDQC GPEKMDSSQS  180
GNNACENQLS EQHKDELGSF DGGYMFAHQP HSDMLRLAPP FESETQLVNE TLQTDNVYCE  240
TLLTDGPSGS YTQNSAPDPH LYWAGAVEGC ATDYTPQMLP GACQSQLVPN DQINNKLNEP  300
SDYMPMDHNV SSQNLRGMRR RCLFNEKSGA ANEGAKNSSA RHSTNSTTPR RKISSSDNNL  360
KTLRTPPCAL PGIGLHLNAL ATVPKDKMVP HNDIQSSLNQ ASNVPSAVGS SPPTDDPHTI  420
NDDSSQTAVV AYVGESSQGS PKKKRHKFDN GDGTSCKRCS CKKSKCLKLY CECFHAGVFC  480
SEPCSCQGCL NMPSNMETVL STREQIESRN PLAFAPKVIR TEPGQELAGG VGCSVSCRCE  540
GCKNAFGRRE GVALLGIEEA KRGCEEKDGG VKEETTDNDK QLVIYQDSIN LTPAESVLAT  600
PSVVDYRPLV ALPPLSSKKP RSSTKLGGYS SRLEGHLKSD ILLSPFESYA EMMLGDGTSN  660
VLKGESSPQT SVKVVSPNKK RVSPPRIGTG LSPICKSGRK LILKSIPSFP SLGVDITNED  720
PNTSSLAP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0739420.0AK073942.1 Oryza sativa Japonica Group cDNA clone:J033075J10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620275.10.0PREDICTED: protein tesmin/TSO1-like CXC 2 isoform X1
TrEMBLA0A0E0RJR00.0A0A0E0RJR0_ORYRU; Uncharacterized protein
STRINGLOC_Os12g41230.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP127462630
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.13e-46Tesmin/TSO1-like CXC domain-containing protein