PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI12G20240.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family CPP
Protein Properties Length: 421aa    MW: 46077.4 Da    PI: 6.4908
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI12G20240.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR43.75.4e-14114151340
              TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      +k+C+CkkskClk+YC Cfa+g++Cse+C C+ C Nk+
  ORUFI12G20240.1 114 CKSCSCKKSKCLKLYCVCFASGSHCSESCGCDPCYNKS 151
                      89**********************************97 PP

2TCR46.28.8e-15190225439
              TCR   4 kgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                      ++C+Ckks ClkkYC+C++ g+ Cs +CkC+dCkN 
  ORUFI12G20240.1 190 RKCTCKKSGCLKKYCDCYQGGAGCSINCKCDDCKNP 225
                      79*********************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1014471.26E-54050No hitNo description
SuperFamilySSF1014471.26E-5103110No hitNo description
SMARTSM011144.5E-9112153IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163428.854113227IPR005172CRC domain
PfamPF036389.9E-10115150IPR005172CRC domain
SMARTSM011147.8E-13187228IPR033467Tesmin/TSO1-like CXC domain
PfamPF036384.9E-11190224IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 421 aa     Download sequence    Send to blast
MSAAEDPAKP PPPPPPQLEA SGSDPDDPLL RDRVVVIAPP PPPPPPPPPP APAPALLAPA  60
ENASAEAAFA VPPAAIAAVV EANGNSEKKK KSVAFVFWSS ISCFWRKTDE GEGCKSCSCK  120
KSKCLKLYCV CFASGSHCSE SCGCDPCYNK SIHGVPRSTP ALPLKAVQTL ETGQDSVEQL  180
IRSPMDFGRR KCTCKKSGCL KKYCDCYQGG AGCSINCKCD DCKNPYGRKV GVILDGKNIL  240
AGPTPNERNG TEADSSDDEE DDYYMNRPLS PVSPSPVSRE SSFQQETLVG VEVQTMNGHL  300
YPKPLTQVRP ESWQLTRRPT EEVRGEAWHY LRRPSEDGTS DVMEGHADPK FQRDNKQLEN  360
HVDRYSIPRC IEVMNAMADL SPIEKSLAPD VFLDPSNREI FLSLTVDIRT MWLKRKMKSL  420
V
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1086640.0AK108664.1 Oryza sativa Japonica Group cDNA clone:002-148-G02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618281.10.0PREDICTED: protein lin-54
TrEMBLA0A0E0RJQ80.0A0A0E0RJQ8_ORYRU; Uncharacterized protein
TrEMBLA2ZMH50.0A2ZMH5_ORYSI; Putative uncharacterized protein
TrEMBLA3CJ810.0A3CJ81_ORYSJ; Uncharacterized protein
STRINGBGIOSGA035877-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP96102834
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.13e-24TESMIN/TSO1-like CXC 2