PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI12G18360.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 739aa    MW: 81638.1 Da    PI: 5.3723
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI12G18360.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3628.7e-1113597311374
             GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                      l++lL++cA+av+++d + a++lL++++++a p+gd++qRla++f+e+L+ar+a+++s + ++l +++ts    ++ l+a++l+  +  + k+s
  ORUFI12G18360.1 359 LRTLLIHCAQAVATDDRRSATELLKQIKQHAKPTGDATQRLAHCFAEGLQARIAGTGSLVHQSLVAKRTS---AVDILQAYQLYMAAICFKKVS 449
                      6789***************************************************999999999999998...9******************** PP

             GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrl 186
                      ++  Nq+I++a  g++++Hi+D++i++G+QWp++l+ +++R++gpp++R+Tg++ p++g   +e++eetg+rL+k+A+e+gvpf++n+++a ++
  ORUFI12G18360.1 450 FIFSNQTIYNASLGKKKIHIVDYGIQYGFQWPCFLRRISQREGGPPEVRMTGIDLPQPGfrPTERIEETGHRLSKYAQEFGVPFKYNAIAAVKM 543
                      **********************************************************9*****************************9999** PP

             GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklprese 280
                      e+++ e+L+++p+E+l+Vn+++q ++l+desv ++s+rd vL+ +++++P+v++++  + + +++ F++rf eal +ysalfd l+a+ prese
  ORUFI12G18360.1 544 ESVRKEDLNIDPDEVLIVNCQYQFKNLMDESVVIDSPRDIVLSNIRKMQPHVFIHAIVNGSFSAPFFVTRFREALFFYSALFDVLDATTPRESE 637
                      ********************************************************************************************** PP

             GRAS 281 erikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      +r  +E+ ++gr++ nv+aceg +r+er et+++W+ r ++aGFk++pl+ ++++ a+  ++ ++ + + ++ ++++l++gWk+r L+++S W+
  ORUFI12G18360.1 638 QRLLIEQNIFGRAALNVIACEGIDRVERPETYKQWQVRNQRAGFKQLPLNPEIVQVARNKVKDCYHKDFVIDIDHQWLLQGWKGRILYAISTWT 731
                      *****************************************************************889*************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.966333711IPR005202Transcription factor GRAS
PfamPF035143.0E-108359731IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 739 aa     Download sequence    Send to blast
MHPQAHPPSP SPAQPSPNHP SPAHPAADXE DDPSLFLYLS DLAPVSPSAY LDLPPSPPPP  60
TTTATTMVKE GEEAPEDLVL PFISRMLMEE DIDDKFFYDY PDNPALLQAQ QPFLEILSDP  120
SSNSRSSNSD DPRLSPTSSS DTSAAINSYD AAATATAVAA AAVPVPQYES IELDPAAFFA  180
AANSDLMSSA FLKGMEEANK FLPTENKLII DLEASSENNY LRGLEEAKRF LPSDDKLQVG  240
FAAAAAPVVS VKKEAVDVVV ATASGGGGRG RKNPYDDEEL ELEGGRSSKQ TAVQGDDVAA  300
RAMFDKVMMP SHENCTEMME KLRIAMKEEA AKNEASAGGK GGNGKVKGGR RGGRDVVDLR  360
TLLIHCAQAV ATDDRRSATE LLKQIKQHAK PTGDATQRLA HCFAEGLQAR IAGTGSLVHQ  420
SLVAKRTSAV DILQAYQLYM AAICFKKVSF IFSNQTIYNA SLGKKKIHIV DYGIQYGFQW  480
PCFLRRISQR EGGPPEVRMT GIDLPQPGFR PTERIEETGH RLSKYAQEFG VPFKYNAIAA  540
VKMESVRKED LNIDPDEVLI VNCQYQFKNL MDESVVIDSP RDIVLSNIRK MQPHVFIHAI  600
VNGSFSAPFF VTRFREALFF YSALFDVLDA TTPRESEQRL LIEQNIFGRA ALNVIACEGI  660
DRVERPETYK QWQVRNQRAG FKQLPLNPEI VQVARNKVKD CYHKDFVIDI DHQWLLQGWK  720
GRILYAISTW TPNDALSYF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-443637308374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149680.0AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
GenBankAL8448780.0AL844878.4 Oryza sativa chromosome 12, . BAC OSJNBb0036A19 of library OSJNBb from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAL7724250.0AL772425.7 Oryza sativa chromosome 12, . BAC OJ1396_C02 of library Monsanto from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAK1115220.0AK111522.1 Oryza sativa Japonica Group cDNA clone:J013002M11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620149.10.0PREDICTED: scarecrow-like protein 34
TrEMBLA0A0E0RJ110.0A0A0E0RJ11_ORYRU; Uncharacterized protein
STRINGLOC_Os12g38490.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-166GRAS family protein