PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI12G10490.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family M-type_MADS
Protein Properties Length: 194aa    MW: 21194.4 Da    PI: 11.2967
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI12G10490.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF69.63e-221966249
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                     ri+nk +rqvtf+kRr g++KKA+EL  L++a vav++fs+  ++y +
  ORUFI12G10490.1 19 RIDNKERRQVTFTKRRGGLFKKASELALLTGASVAVVVFSPAKHVYAF 66
                     8*********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006625.6091070IPR002100Transcription factor, MADS-box
SMARTSM004321.8E-301069IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.62E-261084IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-181232IPR002100Transcription factor, MADS-box
PROSITE patternPS0035001266IPR002100Transcription factor, MADS-box
PfamPF003192.7E-231966IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-183247IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-184768IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MVHPLGRTSM GRQRIEIRRI DNKERRQVTF TKRRGGLFKK ASELALLTGA SVAVVVFSPA  60
KHVYAFGHPS VDAVLRSYAS VPGEAAAVAP VPVHGGSGGE DVDLLGLRLA ADDTGAQVAA  120
EHARMRDVAA RIVQAKAGRR FWWEADVDAL GEAELLEFFT ALKKLRDNVG RHANALLAPQ  180
PPPLPLQQKQ RRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL7139420.0AL713942.4 Oryza sativa chromosome 12, . BAC OSJNBa0009F05 of library OSJNBa from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAP0149680.0AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619582.11e-137agamous-like MADS-box protein AGL61
TrEMBLA0A0E0J6B11e-136A0A0E0J6B1_ORYNI; Uncharacterized protein
TrEMBLA0A0E0RGC01e-136A0A0E0RGC0_ORYRU; Uncharacterized protein
TrEMBLQ2QT501e-136Q2QT50_ORYSJ; Os12g0407000 protein
STRINGORUFI12G10490.11e-137(Oryza rufipogon)
STRINGOS12T0407000-001e-137(Oryza sativa)
STRINGONIVA12G01580.11e-137(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28333088
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.15e-28AGAMOUS-like 61