PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI12G02510.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 828aa    MW: 91492.3 Da    PI: 5.5771
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI12G02510.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.39.2e-10679724550
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                      k+ r+   NReA r++Rq+Kka +++Lee+vk L   N++L k+l+
  ORUFI12G02510.2 679 KKSRKPLGNREAVRKYRQKKKAHTAHLEEEVKRLRVINQQLVKRLQ 724
                      8999999***********************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF549287.47E-36153318IPR012677Nucleotide-binding alpha-beta plait domain
PROSITE profilePS5010217.472156232IPR000504RNA recognition motif domain
SMARTSM003607.7E-23157228IPR000504RNA recognition motif domain
PfamPF000764.3E-17158226IPR000504RNA recognition motif domain
CDDcd005909.40E-21158228No hitNo description
Gene3DG3DSA:3.30.70.3307.0E-38159313IPR012677Nucleotide-binding alpha-beta plait domain
PROSITE profilePS5010211.691234315IPR000504RNA recognition motif domain
SMARTSM003606.1E-12235311IPR000504RNA recognition motif domain
CDDcd005901.14E-11236302No hitNo description
PfamPF000761.5E-10236300IPR000504RNA recognition motif domain
Gene3DG3DSA:3.30.70.3301.5E-22314405IPR012677Nucleotide-binding alpha-beta plait domain
SuperFamilySSF549281.33E-21321407IPR012677Nucleotide-binding alpha-beta plait domain
PROSITE profilePS5010215.528327404IPR000504RNA recognition motif domain
SMARTSM003605.4E-18328400IPR000504RNA recognition motif domain
PfamPF000766.5E-16329397IPR000504RNA recognition motif domain
Gene3DG3DSA:1.20.5.1701.3E-12674743No hitNo description
SMARTSM003386.6E-9675742IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.795677724IPR004827Basic-leucine zipper domain
PfamPF077166.1E-11678731IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.6E-7679724No hitNo description
CDDcd146865.55E-11680733No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0000166Molecular Functionnucleotide binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 828 aa     Download sequence    Send to blast
MQISIPIVFL SFQLETRARR WLIPPNLLGT RPHLPKLPWN FELFKMPRRT DNAASANSVE  60
PEKSEECLEF DDDEEEEVEE EEIEYEEIEE EIEEEEVEED EDVVEEVEEV DEEEDEEEEE  120
ESDETEGVSK TKGVHQKDVT EKGKHAELLA LPPHGSEVYV GGISSDVSSE DLKRLCEPVG  180
EVVEVRMMRG KDDSRGYAFV NFRTKGLALK AVKELNNAKL KGKRIRVSSS QAKNKLFIGN  240
VPHSWTDDDF RKVVEEVGPG VLKADLMKVS SANRNRGYGF VEYYNHACAE YARQEMSSPT  300
FKLDSNAPTV SWADPKNNDS ASTSQVKSVY VKNLPKNVTQ AQLKRLFEHH GEIEKVVLPP  360
SRGGHDNRYG FVHFKDRSMA MRALQNTERY ELDGQVLDCS LAKPPAADKK DDRVPLPSSN  420
GAPLLPSYPP LGYGIMSVPG AYGDAPASTA QPMLYAPRAP PGAAMVPMML PDGRLVYVVQ  480
QPGGQLPLAS PPPQQAGHRS GSGGRHGGSG GRYGGGGGSS GSSRPEECVS ETRLYMRILP  540
VSQSAESDGA LYRQFTPVSH MDYEISGPES EVDSEVWLGW VAQRRRRRAT APYSGRRRVH  600
EASDAGDDTA IRRSWQQVKE IPTSLDDFLP SIRTTCTHTH TCNPPGPSAT EHTHTCYHTH  660
TRVFSSDDDS CGGDKAKPKK SRKPLGNREA VRKYRQKKKA HTAHLEEEVK RLRVINQQLV  720
KRLQGQAALE VEVVRLRSLL VDVRSRINGA LGSCPIQAQC GVDNVLGCDG MAQCFAGKPE  780
LGVRQSCAPS TVNCHISSDS GQNLVVPHAL SPSDVIGSFM VSSTSKDE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1509517GGRYGGGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0687000.0AK068700.1 Oryza sativa Japonica Group cDNA clone:J013160I09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619730.10.0PREDICTED: heterogeneous nuclear ribonucleoprotein Q isoform X1
TrEMBLA0A0E0RDH00.0A0A0E0RDH0_ORYRU; Uncharacterized protein
STRINGBGIOSGA036957-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP94289
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35040.18e-19bZIP family protein