PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI12G02510.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 783aa    MW: 86094.8 Da    PI: 5.2499
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI12G02510.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.48.6e-10634679550
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                      k+ r+   NReA r++Rq+Kka +++Lee+vk L   N++L k+l+
  ORUFI12G02510.1 634 KKSRKPLGNREAVRKYRQKKKAHTAHLEEEVKRLRVINQQLVKRLQ 679
                      8999999***********************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF549286.69E-36108273IPR012677Nucleotide-binding alpha-beta plait domain
Gene3DG3DSA:3.30.70.3304.4E-23110187IPR012677Nucleotide-binding alpha-beta plait domain
PROSITE profilePS5010217.472111187IPR000504RNA recognition motif domain
SMARTSM003607.7E-23112183IPR000504RNA recognition motif domain
CDDcd005908.44E-21113183No hitNo description
PfamPF000764.0E-17113181IPR000504RNA recognition motif domain
Gene3DG3DSA:3.30.70.3301.4E-15188267IPR012677Nucleotide-binding alpha-beta plait domain
PROSITE profilePS5010211.691189270IPR000504RNA recognition motif domain
SMARTSM003606.1E-12190266IPR000504RNA recognition motif domain
PfamPF000761.4E-10191255IPR000504RNA recognition motif domain
CDDcd005901.05E-11191257No hitNo description
Gene3DG3DSA:3.30.70.3301.3E-22268360IPR012677Nucleotide-binding alpha-beta plait domain
SuperFamilySSF549281.22E-21276362IPR012677Nucleotide-binding alpha-beta plait domain
PROSITE profilePS5010215.528282359IPR000504RNA recognition motif domain
SMARTSM003605.4E-18283355IPR000504RNA recognition motif domain
PfamPF000766.0E-16284352IPR000504RNA recognition motif domain
Gene3DG3DSA:1.20.5.1701.2E-12629698No hitNo description
SMARTSM003386.6E-9630697IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.795632679IPR004827Basic-leucine zipper domain
PfamPF077165.7E-11633686IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.39E-7634679No hitNo description
CDDcd146865.58E-11635688No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0000166Molecular Functionnucleotide binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 783 aa     Download sequence    Send to blast
MPRRTDNAAS ANSVEPEKSE ECLEFDDDEE EEVEEEEIEY EEIEEEIEEE EVEEDEDVVE  60
EVEEVDEEED EEEEEESDET EGVSKTKGVH QKDVTEKGKH AELLALPPHG SEVYVGGISS  120
DVSSEDLKRL CEPVGEVVEV RMMRGKDDSR GYAFVNFRTK GLALKAVKEL NNAKLKGKRI  180
RVSSSQAKNK LFIGNVPHSW TDDDFRKVVE EVGPGVLKAD LMKVSSANRN RGYGFVEYYN  240
HACAEYARQE MSSPTFKLDS NAPTVSWADP KNNDSASTSQ VKSVYVKNLP KNVTQAQLKR  300
LFEHHGEIEK VVLPPSRGGH DNRYGFVHFK DRSMAMRALQ NTERYELDGQ VLDCSLAKPP  360
AADKKDDRVP LPSSNGAPLL PSYPPLGYGI MSVPGAYGDA PASTAQPMLY APRAPPGAAM  420
VPMMLPDGRL VYVVQQPGGQ LPLASPPPQQ AGHRSGSGGR HGGSGGRYGG GGGSSGSSRP  480
EECVSETRLY MRILPVSQSA ESDGALYRQF TPVSHMDYEI SGPESEVDSE VWLGWVAQRR  540
RRRATAPYSG RRRVHEASDA GDDTAIRRSW QQVKEIPTSL DDFLPSIRTT CTHTHTCNPP  600
GPSATEHTHT CYHTHTRVFS SDDDSCGGDK AKPKKSRKPL GNREAVRKYR QKKKAHTAHL  660
EEEVKRLRVI NQQLVKRLQG QAALEVEVVR LRSLLVDVRS RINGALGSCP IQAQCGVDNV  720
LGCDGMAQCF AGKPELGVRQ SCAPSTVNCH ISSDSGQNLV VPHALSPSDV IGSFMVSSTS  780
KDE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1464472GGRYGGGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0694930.0AK069493.1 Oryza sativa Japonica Group cDNA clone:J023024M07, full insert sequence.
GenBankAK0687000.0AK068700.1 Oryza sativa Japonica Group cDNA clone:J013160I09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619732.10.0PREDICTED: heterogeneous nuclear ribonucleoprotein Q isoform X2
RefseqXP_015619733.10.0PREDICTED: heterogeneous nuclear ribonucleoprotein Q isoform X2
RefseqXP_015619734.10.0PREDICTED: heterogeneous nuclear ribonucleoprotein Q isoform X2
TrEMBLA0A0E0RDH10.0A0A0E0RDH1_ORYRU; Uncharacterized protein
STRINGBGIOSGA036957-PA0.0(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35040.18e-19bZIP family protein