PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI11G25590.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 600aa    MW: 67578 Da    PI: 6.9744
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI11G25590.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS286.38.6e-882215902373
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                      + lL++cA+a ++++++ a +lL++++++a  +gd+mqR+a+yf+++L+arla+ +++ly+     ++ +++ +e l+++kl+  ++ + k++ 
  ORUFI11G25590.1 221 RLLLIQCAQATATDNQQSAGELLKKIKQHALATGDAMQRVAHYFAKGLEARLAGRGKHLYQ-----NQMRMSLVEYLKVYKLYMAACCFTKVAL 309
                      568***************************************************9999994.....33446699******************** PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrle 187
                      + a  +I++av+g++r+Hi+D++   Gl+Wp Ll+ L sR++gpp++RiT v+  ++     +++ee g+ L++ A+e++vpf+f++++a ++e
  ORUFI11G25590.1 310 MFAAMTIMQAVQGKKRLHIVDYGPRCGLHWPDLLRRLGSREDGPPEVRITIVDILQPAfrPFQRIEEAGHCLSSCANEFRVPFRFQAVAAAKWE 403
                      *****************************************************99998999**************************9999*** PP

             GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                      ++  e+L+++p+E+l+Vn   +   l+desv  +   +rd  L+ + +++P+v++    + ++ ++sFl rf   l yysalfd l+a+ pr+s
  ORUFI11G25590.1 404 TVGAEDLHIEPDEVLVVNDLWSFSALMDESVFCDGpnPRDVALRNISKMQPDVFIQGITNDSY-GASFLSRFRAVLLYYSALFDILDATTPRDS 496
                      ******************************98776669******************9999888.789*************************** PP

             GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                        r  +E+ +lg+ + n++acega+ +er e++++W++r ++aG+++++l+ +++++++  ++k++ + + + e+ ++l++gW++r L++ SaW
  ORUFI11G25590.1 497 GLRLALEQNVLGPYALNAIACEGADLVERPEKYKQWQARNHRAGMQQLKLRPDIVDTIRDEVNKYHHKDFLLGEDGQWLLQGWMGRILFAHSAW 590
                      ******************************************************************888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098551.443194571IPR005202Transcription factor GRAS
PfamPF035143.0E-85221590IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 600 aa     Download sequence    Send to blast
MANPEDFFWE ALLKENRRTK HHPQAPSPPP VFFDLPATPL SNSDGTDPSS LDNQLLSYVS  60
RMLMEDEMGS SAAITNLQCV NRGSTEEANN MLPGSEVVRV FSKGMGEASK LLPRNNSFRT  120
LETVDQVSSD GHCRGRKKKN HDRDEQQLEE ERGRSSKLAA LTIAGTQEAG ARELLDELML  180
HAHETCIKDM EKLRIDMDNE AEKKINKKDK KGSSSKVVDL RLLLIQCAQA TATDNQQSAG  240
ELLKKIKQHA LATGDAMQRV AHYFAKGLEA RLAGRGKHLY QNQMRMSLVE YLKVYKLYMA  300
ACCFTKVALM FAAMTIMQAV QGKKRLHIVD YGPRCGLHWP DLLRRLGSRE DGPPEVRITI  360
VDILQPAFRP FQRIEEAGHC LSSCANEFRV PFRFQAVAAA KWETVGAEDL HIEPDEVLVV  420
NDLWSFSALM DESVFCDGPN PRDVALRNIS KMQPDVFIQG ITNDSYGASF LSRFRAVLLY  480
YSALFDILDA TTPRDSGLRL ALEQNVLGPY ALNAIACEGA DLVERPEKYK QWQARNHRAG  540
MQQLKLRPDI VDTIRDEVNK YHHKDFLLGE DGQWLLQGWM GRILFAHSAW VRQSQDTSSG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-282245908374GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1242247LKKIKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126190.0CP012619.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 11 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616387.10.0PREDICTED: scarecrow-like protein 9
TrEMBLA0A0E0RCD30.0A0A0E0RCD3_ORYRU; Uncharacterized protein
STRINGLOC_Os11g47920.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-111GRAS family protein