PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI11G25580.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 599aa    MW: 67059.5 Da    PI: 6.4664
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI11G25580.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS299.11.1e-912205892373
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                      + lL++cA+a+++++++ a +lL++++++a  +gd+mqR+a+yf+++L+arla+s+++ly+  +     +++ +e l+++kl+  ++ + k++ 
  ORUFI11G25580.1 220 RMLLIQCAQAMATDNQQSAGELLKKIKQHALATGDAMQRVAHYFAKGLEARLAGSGKHLYQ--NHV---RMSLVEYLKVYKLYMAACCFKKVAL 308
                      679*********************************************************5..233...34489******************** PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrle 187
                      + a  +I++av+g++r+Hi+D++i  Gl+Wp L++ L sR++gpp++RiT v+ p++g    +++e+ g+ L++ A++++vpf+f+++va ++e
  ORUFI11G25580.1 309 MFAAMTIMQAVQGKKRLHIVDYGIRCGLHWPDLFRRLGSREDGPPEVRITIVDIPQPGfrPFQRIEAAGHCLSSCANKFRVPFRFQAVVAAKWE 402
                      *********************************************************9999********************************* PP

             GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                      ++  e+L+++p+E+l+Vn   +   l+desv  +   +rd  L+ + +++P+v++    + ++ ++sFl rf  al yysalfd+l+a+ pres
  ORUFI11G25580.1 403 TVGAEDLHIEPDEVLVVNDLWSFSALMDESVFCDGpnPRDVALRNISKMQPDVFIQGIINGSY-GASFLSRFRGALLYYSALFDMLDATTPRES 495
                      ******************************98776669************************9.789*************************** PP

             GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                        r  +E+ +lg+ + n++acega+ +er e++++W++r ++aG+++++l+ +++++++  ++k++ + + + e+ ++l++gW++r L++ SaW
  ORUFI11G25580.1 496 GLRLALEQNVLGPYALNAIACEGADLVERPEKYRQWQARNHRAGMQQLKLRPDIVDTIREEVNKYHHKDFLLGEDGQWLLQGWMGRVLFAHSAW 589
                      ******************************************************************888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098552.433193570IPR005202Transcription factor GRAS
PfamPF035143.9E-89220589IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 599 aa     Download sequence    Send to blast
MANPEDFFWE ALLKEENEAP SPPSPSPVFF ELPPTPLANS DGSTDPSSLL DNQLLSYVSS  60
MLMEDEIGSS AAVTNLQCVN RGSTEEANNM LPGSEVVRAF LKGMEEASKL LPRNNSFRML  120
ETVDQVSSHG HCRGGKKKNH DRDEQQLEEE LGRSSKLAAM TNAGTEEAGA RELLDELMLH  180
SHETCIKDME KLRIDMDNEA DKTIKKKGKK GSSSKVVDLR MLLIQCAQAM ATDNQQSAGE  240
LLKKIKQHAL ATGDAMQRVA HYFAKGLEAR LAGSGKHLYQ NHVRMSLVEY LKVYKLYMAA  300
CCFKKVALMF AAMTIMQAVQ GKKRLHIVDY GIRCGLHWPD LFRRLGSRED GPPEVRITIV  360
DIPQPGFRPF QRIEAAGHCL SSCANKFRVP FRFQAVVAAK WETVGAEDLH IEPDEVLVVN  420
DLWSFSALMD ESVFCDGPNP RDVALRNISK MQPDVFIQGI INGSYGASFL SRFRGALLYY  480
SALFDMLDAT TPRESGLRLA LEQNVLGPYA LNAIACEGAD LVERPEKYRQ WQARNHRAGM  540
QQLKLRPDIV DTIREEVNKY HHKDFLLGED GQWLLQGWMG RVLFAHSAWV PQQQDNSSG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-322235898374GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1241246LKKIKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126190.0CP012619.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 11 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616386.10.0PREDICTED: scarecrow-like protein 9
TrEMBLA0A0E0RCD20.0A0A0E0RCD2_ORYRU; Uncharacterized protein
STRINGBGIOSGA035744-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-120GRAS family protein