PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI11G25540.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 635aa    MW: 70009.8 Da    PI: 4.6174
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI11G25540.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS289.41e-883046112304
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                       +lL++cA+av+++d + a++lL+++++++s +gd++qRla +f+e+L+arla+++s++yk+l ++ ts   +++ l+a+klf  ++ i k+s+
  ORUFI11G25540.1 304 HTLLIHCAQAVATSDRRSATELLKQIKQNSSARGDATQRLACCFAEGLEARLAGTGSQVYKSLVAKCTS---TVDFLKAYKLFAAACCIKKVSF 394
                      679**************************************************************9999...8********************* PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrle 187
                      +  N++Il+av+g++++Hi+D+++s+G+QWp L++ L++R++gpp++RiTg++ p++g   ++++eetg+rL++ A+++gvpf+f++ +a ++e
  ORUFI11G25540.1 395 IFSNKTILDAVAGKRKLHIVDYGLSYGFQWPGLFKCLSEREGGPPEVRITGIDFPQPGfrPADQIEETGRRLSNCARQFGVPFRFQA-IAAKWE 487
                      *********************************************************9*****************************.799*** PP

             GRAS 188 dleleeLrvkp.....gEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak 274
                      +++ e+L++++     +E+l+Vn+ + l  l desv ++s  +rd vL+ +++++P+v+v +  +  ++++ Fl+rf e+l +ys+ fd+l+a+
  ORUFI11G25540.1 488 TVRREDLHLDReeeeeEEVLVVNCLHFLNALQDESVVVDSpsPRDMVLNNIRDMRPHVFVKCVVNGAYGAPFFLTRFRETLFFYSSQFDMLDAT 581
                      ********9999999999*****************98888779*************************************************** PP

             GRAS 275 lpreseerikvErellgreivnvvacegae 304
                      +pr+++er  +Er +lgr + nv+acegae
  ORUFI11G25540.1 582 IPRDNDERLLIERDILGRCALNVIACEGAE 611
                      ****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098553.3277635IPR005202Transcription factor GRAS
PfamPF035143.5E-86304611IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 635 aa     Download sequence    Send to blast
MAAAAPQLEE LVDLEPFSPS LFLDLPPTPH SDDPNDDDLI LPFISRMLME DDIDDKFFYQ  60
FPDHPALLHA QQPYAQILDA PSDDTTTNSS DDSASATTNN TTNSAATANA SWPYDPIELS  120
QLLQSPPHPV SDNHDADVGD TRSAPEDDKD LKLLFSAADN MEMLNMAFLK GREEANKLVP  180
TNNTLFAGFD GASLLKTEPA VDEPTLMFGR SGGSGRGRKN RHGEEDDLEA ETGRSSKLMV  240
PPQEDTAAAS EMFDEIMFNG YEVIMKGMEE LRVAMDSEAE KKARNGGGAG RRAARAKAAV  300
VDLHTLLIHC AQAVATSDRR SATELLKQIK QNSSARGDAT QRLACCFAEG LEARLAGTGS  360
QVYKSLVAKC TSTVDFLKAY KLFAAACCIK KVSFIFSNKT ILDAVAGKRK LHIVDYGLSY  420
GFQWPGLFKC LSEREGGPPE VRITGIDFPQ PGFRPADQIE ETGRRLSNCA RQFGVPFRFQ  480
AIAAKWETVR REDLHLDREE EEEEEVLVVN CLHFLNALQD ESVVVDSPSP RDMVLNNIRD  540
MRPHVFVKCV VNGAYGAPFF LTRFRETLFF YSSQFDMLDA TIPRDNDERL LIERDILGRC  600
ALNVIACEGA EGGGWCAPTG PASRSCHCSL RWLSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-313075988289GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1370640.0AC137064.4 Oryza sativa Japonica Group cultivar Nipponbare chromosome 11 clone OSJNBb0003C04 map S10003, complete sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015617900.10.0PREDICTED: scarecrow-like protein 9
TrEMBLA0A0E0RCC80.0A0A0E0RCC8_ORYRU; Uncharacterized protein
STRINGBGIOSGA035741-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.16e-94GRAS family protein