PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI11G23650.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family M-type_MADS
Protein Properties Length: 426aa    MW: 46726.6 Da    PI: 6.5533
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI11G23650.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF63.13.1e-204487245
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                     + en+s r+vt+skRr gilKKA+ELS+LCd+   +++fs+++k
  ORUFI11G23650.1 44 KLENSSGRHVTYSKRRSGILKKAKELSILCDIPLILLMFSPNDK 87
                     679*************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.2543587IPR002100Transcription factor, MADS-box
SMARTSM004321.1E-263594IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.75E-2436129IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-153757IPR002100Transcription factor, MADS-box
PfamPF003192.7E-174588IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-155772IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-157293IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 426 aa     Download sequence    Send to blast
MLALCAGDSI VGQGSDLCVE DSSPSLRRGD SASAMGRVKL KIKKLENSSG RHVTYSKRRS  60
GILKKAKELS ILCDIPLILL MFSPNDKPTI CVGDHSSIED VITKYAQQTP QERAKRKLES  120
LEALKKTFKK LDHDVNIQDF LGSGGQTVEM LIKSIVWQEL SSHLGALQCQ MADVEKRLSY  180
WSDPEKVENI DHIRAMEQSL KESLNRIRIH KENFAKQHLM SLQCAAAQFQ NDMKLPLGLT  240
GDPNTSSWFH GGGGAEAQQP MMLPEDPSLL HQRDIGCSAS TSLQSYPGYF SMGKQSTDNA  300
GGGEQHHHAA VQQQPEFSQA DCLTSLQLGA QFPYPSAFDN AGLLSDRLFD NAAAAAAAMD  360
FGGHYDLPRP GDEASFQNWA SAACGATMYD HHQQQQQQQQ PAQLPAAATV EAPSFNHPSP  420
HRQLMI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFM9565050.0FM956505.1 Oryza sativa Japonica Group mRNA for MADS68 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618002.10.0agamous-like MADS-box protein AGL65 isoform X1
TrEMBLA0A0E0RBQ50.0A0A0E0RBQ5_ORYRU; Uncharacterized protein
STRINGORUFI11G23650.10.0(Oryza rufipogon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46263659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.12e-82AGAMOUS-like 65